notbugAs an Amazon Associate I earn from qualifying purchases.
Want a good read? Try FreeBSD Mastery: Jails (IT Mastery Book 15)

Current status

The server has been repaired, with a new power supply, for $23. I am waiting for lower COVID rates before visiting the datacenter to return it.
Port details
qt5-doc Qt 5 documentation
5.12.2 misc on this many watch lists=0 search for ports that depend on this port Find issues related to this port Report an issue related to this port View this port on Repology. pkg-fallout 5.12.2Version of this port present on the latest quarterly branch.
Maintainer: search for ports maintained by this maintainer
Port Added: 2016-05-31 20:39:07
Last Update: 2019-10-01 05:13:31
SVN Revision: 513447
License: not specified in port
SVNWeb : Homepage
pkg-plist: as obtained via: make generate-plist
Expand this list (15991 items)
Collapse this list.
  1. share/doc/qt5/activeqt.qch
  2. share/doc/qt5/activeqt/activeqt-activeqt-comapp-comapp-pro.html
  3. share/doc/qt5/activeqt/activeqt-activeqt-comapp-example.html
  4. share/doc/qt5/activeqt/activeqt-activeqt-comapp-main-cpp.html
  5. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-example.html
  6. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-hierarchy-pro.html
  7. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-main-cpp.html
  8. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-cpp.html
  9. share/doc/qt5/activeqt/activeqt-activeqt-hierarchy-objects-h.html
  10. share/doc/qt5/activeqt/activeqt-activeqt-mediaplayer-example.html
  11. share/doc/qt5/activeqt/activeqt-activeqt-mediaplayer-main-cpp.html
  12. share/doc/qt5/activeqt/activeqt-activeqt-mediaplayer-mainwindow-ui.html
  13. share/doc/qt5/activeqt/activeqt-activeqt-mediaplayer-mediaaxwidget-h.html
  14. share/doc/qt5/activeqt/activeqt-activeqt-mediaplayer-mediaplayer-pro.html
  15. share/doc/qt5/activeqt/activeqt-activeqt-menus-example.html
  16. share/doc/qt5/activeqt/activeqt-activeqt-menus-main-cpp.html
  17. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-cpp.html
  18. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-h.html
  19. share/doc/qt5/activeqt/activeqt-activeqt-menus-menus-pro.html
  20. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax1-h.html
  21. share/doc/qt5/activeqt/activeqt-activeqt-multiple-ax2-h.html
  22. share/doc/qt5/activeqt/activeqt-activeqt-multiple-example.html
  23. share/doc/qt5/activeqt/activeqt-activeqt-multiple-main-cpp.html
  24. share/doc/qt5/activeqt/activeqt-activeqt-multiple-multiple-pro.html
  25. share/doc/qt5/activeqt/activeqt-activeqt-opengl-example.html
  26. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-cpp.html
  27. share/doc/qt5/activeqt/activeqt-activeqt-opengl-glbox-h.html
  28. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-cpp.html
  29. share/doc/qt5/activeqt/activeqt-activeqt-opengl-globjwin-h.html
  30. share/doc/qt5/activeqt/activeqt-activeqt-opengl-main-cpp.html
  31. share/doc/qt5/activeqt/activeqt-activeqt-opengl-opengl-pro.html
  32. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-cpp.html
  33. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-addressview-h.html
  34. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-example.html
  35. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-main-cpp.html
  36. share/doc/qt5/activeqt/activeqt-activeqt-qutlook-qutlook-pro.html
  37. share/doc/qt5/activeqt/activeqt-activeqt-simple-example.html
  38. share/doc/qt5/activeqt/activeqt-activeqt-simple-main-cpp.html
  39. share/doc/qt5/activeqt/activeqt-activeqt-simple-simple-pro.html
  40. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-example.html
  41. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-main-cpp.html
  42. share/doc/qt5/activeqt/activeqt-activeqt-wrapper-wrapper-pro.html
  43. share/doc/qt5/activeqt/activeqt-container.html
  44. share/doc/qt5/activeqt/activeqt-dotnet.html
  45. share/doc/qt5/activeqt/activeqt-dumpcpp.html
  46. share/doc/qt5/activeqt/activeqt-dumpdoc.html
  47. share/doc/qt5/activeqt/activeqt-index.html
  48. share/doc/qt5/activeqt/activeqt-server.html
  49. share/doc/qt5/activeqt/activeqt-tools.html
  50. share/doc/qt5/activeqt/activeqt.index
  51. share/doc/qt5/activeqt/activeqt.qhp
  52. share/doc/qt5/activeqt/activeqt.qhp.sha1
  53. share/doc/qt5/activeqt/activeqt.tags
  54. share/doc/qt5/activeqt/examples-manifest.xml
  55. share/doc/qt5/activeqt/images/activeqt-mediaplayer-example.jpg
  56. share/doc/qt5/activeqt/images/arrow_bc.png
  57. share/doc/qt5/activeqt/images/bgrContent.png
  58. share/doc/qt5/activeqt/images/btn_next.png
  59. share/doc/qt5/activeqt/images/btn_prev.png
  60. share/doc/qt5/activeqt/images/bullet_dn.png
  61. share/doc/qt5/activeqt/images/bullet_sq.png
  62. share/doc/qt5/activeqt/images/home.png
  63. share/doc/qt5/activeqt/images/ico_note.png
  64. share/doc/qt5/activeqt/images/ico_note_attention.png
  65. share/doc/qt5/activeqt/images/ico_out.png
  66. share/doc/qt5/activeqt/images/logo.png
  67. share/doc/qt5/activeqt/qaxaggregated-members.html
  68. share/doc/qt5/activeqt/qaxaggregated.html
  69. share/doc/qt5/activeqt/qaxbase-members.html
  70. share/doc/qt5/activeqt/qaxbase.html
  71. share/doc/qt5/activeqt/qaxbindable-members.html
  72. share/doc/qt5/activeqt/qaxbindable.html
  73. share/doc/qt5/activeqt/qaxcontainer-module.html
  74. share/doc/qt5/activeqt/qaxfactory-members.html
  75. share/doc/qt5/activeqt/qaxfactory-obsolete.html
  76. share/doc/qt5/activeqt/qaxfactory.html
  77. share/doc/qt5/activeqt/qaxobject-members.html
  78. share/doc/qt5/activeqt/qaxobject-obsolete.html
  79. share/doc/qt5/activeqt/qaxobject.html
  80. share/doc/qt5/activeqt/qaxscript-members.html
  81. share/doc/qt5/activeqt/qaxscript-obsolete.html
  82. share/doc/qt5/activeqt/qaxscript.html
  83. share/doc/qt5/activeqt/qaxscriptengine-members.html
  84. share/doc/qt5/activeqt/qaxscriptengine-obsolete.html
  85. share/doc/qt5/activeqt/qaxscriptengine.html
  86. share/doc/qt5/activeqt/qaxscriptmanager-members.html
  87. share/doc/qt5/activeqt/qaxscriptmanager-obsolete.html
  88. share/doc/qt5/activeqt/qaxscriptmanager.html
  89. share/doc/qt5/activeqt/qaxselect-members.html
  90. share/doc/qt5/activeqt/qaxselect-obsolete.html
  91. share/doc/qt5/activeqt/qaxselect.html
  92. share/doc/qt5/activeqt/qaxserver-demo-hierarchy.html
  93. share/doc/qt5/activeqt/qaxserver-demo-menus.html
  94. share/doc/qt5/activeqt/qaxserver-demo-multiple.html
  95. share/doc/qt5/activeqt/qaxserver-demo-opengl.html
  96. share/doc/qt5/activeqt/qaxserver-demo-simple.html
  97. share/doc/qt5/activeqt/qaxserver-demo-wrapper.html
  98. share/doc/qt5/activeqt/qaxserver-module.html
  99. share/doc/qt5/activeqt/qaxwidget-members.html
  100. share/doc/qt5/activeqt/qaxwidget-obsolete.html
  101. share/doc/qt5/activeqt/qaxwidget.html
  102. share/doc/qt5/activeqt/style/offline-simple.css
  103. share/doc/qt5/activeqt/style/offline.css
  104. share/doc/qt5/gammaray-manual.qch
  105. share/doc/qt5/gammaray-manual/examples-gammaray.html
  106. share/doc/qt5/gammaray-manual/examples-manifest.xml
  107. share/doc/qt5/gammaray-manual/gammaray-action-inspector.html
  108. share/doc/qt5/gammaray-manual/gammaray-advanced-usage.html
  109. share/doc/qt5/gammaray-manual/gammaray-application-attributes.html
  110. share/doc/qt5/gammaray-manual/gammaray-basic-operations.html
  111. share/doc/qt5/gammaray-manual/gammaray-classinfo.html
  112. share/doc/qt5/gammaray-manual/gammaray-client.html
  113. share/doc/qt5/gammaray-manual/gammaray-codec-browser.html
  114. share/doc/qt5/gammaray-manual/gammaray-command-line.html
  115. share/doc/qt5/gammaray-manual/gammaray-connections.html
  116. share/doc/qt5/gammaray-manual/gammaray-enums.html
  117. share/doc/qt5/gammaray-manual/gammaray-font-browser.html
  118. share/doc/qt5/gammaray-manual/gammaray-geo-positioning.html
  119. share/doc/qt5/gammaray-manual/gammaray-getting-started.html
  120. share/doc/qt5/gammaray-manual/gammaray-graphicsscene-inspector.html
  121. share/doc/qt5/gammaray-manual/gammaray-http-cookies.html
  122. share/doc/qt5/gammaray-manual/gammaray-install.html
  123. share/doc/qt5/gammaray-manual/gammaray-launcher-gui.html
  124. share/doc/qt5/gammaray-manual/gammaray-licenses-and-attributions.html
  125. share/doc/qt5/gammaray-manual/gammaray-locales.html
  126. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-backward-cpp.html
  127. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-kitemmodels.html
  128. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-kuserfeedback.html
  129. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-lz4.html
  130. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-qt.html
  131. share/doc/qt5/gammaray-manual/gammaray-manual-attribution-stackwalker.html
  132. share/doc/qt5/gammaray-manual/gammaray-manual.qhp
  133. share/doc/qt5/gammaray-manual/gammaray-manual.qhp.sha1
  134. share/doc/qt5/gammaray-manual/gammaray-messages.html
  135. share/doc/qt5/gammaray-manual/gammaray-metaobject-browser.html
  136. share/doc/qt5/gammaray-manual/gammaray-metatype-browser.html
  137. share/doc/qt5/gammaray-manual/gammaray-methods.html
  138. share/doc/qt5/gammaray-manual/gammaray-mime-types.html
  139. share/doc/qt5/gammaray-manual/gammaray-model-inspector.html
  140. share/doc/qt5/gammaray-manual/gammaray-network.html
  141. share/doc/qt5/gammaray-manual/gammaray-object-inspection.html
  142. share/doc/qt5/gammaray-manual/gammaray-paint-analyzer.html
  143. share/doc/qt5/gammaray-manual/gammaray-properties.html
  144. share/doc/qt5/gammaray-manual/gammaray-qmlbindings.html
  145. share/doc/qt5/gammaray-manual/gammaray-qmlcontext.html
  146. share/doc/qt5/gammaray-manual/gammaray-qmltype.html
  147. share/doc/qt5/gammaray-manual/gammaray-qobject-browser.html
  148. share/doc/qt5/gammaray-manual/gammaray-qresource-browser.html
  149. share/doc/qt5/gammaray-manual/gammaray-qsggeometry.html
  150. share/doc/qt5/gammaray-manual/gammaray-qsgmaterial.html
  151. share/doc/qt5/gammaray-manual/gammaray-qsgtexture.html
  152. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-example.html
  153. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-mycylinder-cpp.html
  154. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-mycylinder-h.html
  155. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-qt3d-geometry-cpp.html
  156. share/doc/qt5/gammaray-manual/gammaray-qt3d-geometry-qt3d-geometry-pro.html
  157. share/doc/qt5/gammaray-manual/gammaray-qt3d-inspector.html
  158. share/doc/qt5/gammaray-manual/gammaray-qt3dgeometry-inspector.html
  159. share/doc/qt5/gammaray-manual/gammaray-qtcreator.html
  160. share/doc/qt5/gammaray-manual/gammaray-qtquick2-inspector.html
  161. share/doc/qt5/gammaray-manual/gammaray-quick-batching-example.html
  162. share/doc/qt5/gammaray-manual/gammaray-quick-batching-quick-batching-pro.html
  163. share/doc/qt5/gammaray-manual/gammaray-quick-batching-quick-batching-qml.html
  164. share/doc/qt5/gammaray-manual/gammaray-quick-batching-slider-qml.html
  165. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-example.html
  166. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-quick-event-handling-pro.html
  167. share/doc/qt5/gammaray-manual/gammaray-quick-event-handling-quick-event-handling-qml.html
  168. share/doc/qt5/gammaray-manual/gammaray-signal-plotter.html
  169. share/doc/qt5/gammaray-manual/gammaray-signal-slot-example.html
  170. share/doc/qt5/gammaray-manual/gammaray-signal-slot-signal-slot-cpp.html
  171. share/doc/qt5/gammaray-manual/gammaray-signal-slot-signal-slot-pro.html
  172. share/doc/qt5/gammaray-manual/gammaray-stack-trace.html
  173. share/doc/qt5/gammaray-manual/gammaray-standard-paths.html
  174. share/doc/qt5/gammaray-manual/gammaray-state-machine-debugger.html
  175. share/doc/qt5/gammaray-manual/gammaray-state-machine-example.html
  176. share/doc/qt5/gammaray-manual/gammaray-state-machine-state-machine-pro.html
  177. share/doc/qt5/gammaray-manual/gammaray-state-machine-state-machine-qml.html
  178. share/doc/qt5/gammaray-manual/gammaray-styles.html
  179. share/doc/qt5/gammaray-manual/gammaray-text-documents.html
  180. share/doc/qt5/gammaray-manual/gammaray-timer-example.html
  181. share/doc/qt5/gammaray-manual/gammaray-timer-timer-cpp.html
  182. share/doc/qt5/gammaray-manual/gammaray-timer-timer-pro.html
  183. share/doc/qt5/gammaray-manual/gammaray-timertop.html
  184. share/doc/qt5/gammaray-manual/gammaray-tools.html
  185. share/doc/qt5/gammaray-manual/gammaray-translator-inspector.html
  186. share/doc/qt5/gammaray-manual/gammaray-wayland-compositors.html
  187. share/doc/qt5/gammaray-manual/gammaray-web-inspector.html
  188. share/doc/qt5/gammaray-manual/gammaray-widget-attributes.html
  189. share/doc/qt5/gammaray-manual/gammaray-widget-inspector.html
  190. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-example.html
  191. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-widget-layouting-cpp.html
  192. share/doc/qt5/gammaray-manual/gammaray-widget-layouting-widget-layouting-pro.html
  193. share/doc/qt5/gammaray-manual/gammaray.index
  194. share/doc/qt5/gammaray-manual/images/gammaray-action-inspector.png
  195. share/doc/qt5/gammaray-manual/images/gammaray-application-attributes.png
  196. share/doc/qt5/gammaray-manual/images/gammaray-bindings.png
  197. share/doc/qt5/gammaray-manual/images/gammaray-classinfo.png
  198. share/doc/qt5/gammaray-manual/images/gammaray-codec-browser.png
  199. share/doc/qt5/gammaray-manual/images/gammaray-connections.png
  200. share/doc/qt5/gammaray-manual/images/gammaray-enums.png
  201. share/doc/qt5/gammaray-manual/images/gammaray-font-browser.png
  202. share/doc/qt5/gammaray-manual/images/gammaray-geo-positioning.png
  203. share/doc/qt5/gammaray-manual/images/gammaray-graphicsitem-paint-analyzer.png
  204. share/doc/qt5/gammaray-manual/images/gammaray-graphicsscene-inspector.png
  205. share/doc/qt5/gammaray-manual/images/gammaray-http-cookies.png
  206. share/doc/qt5/gammaray-manual/images/gammaray-launcher-attach.png
  207. share/doc/qt5/gammaray-manual/images/gammaray-launcher-connect.png
  208. share/doc/qt5/gammaray-manual/images/gammaray-launcher-launch.png
  209. share/doc/qt5/gammaray-manual/images/gammaray-launcher-selftest.png
  210. share/doc/qt5/gammaray-manual/images/gammaray-locales.png
  211. share/doc/qt5/gammaray-manual/images/gammaray-logging-categories.png
  212. share/doc/qt5/gammaray-manual/images/gammaray-metaobject-browser.png
  213. share/doc/qt5/gammaray-manual/images/gammaray-metatype-browser.png
  214. share/doc/qt5/gammaray-manual/images/gammaray-method-invocation.png
  215. share/doc/qt5/gammaray-manual/images/gammaray-methods.png
  216. share/doc/qt5/gammaray-manual/images/gammaray-mime-types.png
  217. share/doc/qt5/gammaray-manual/images/gammaray-model-inspector.png
  218. share/doc/qt5/gammaray-manual/images/gammaray-network-interfaces.png
  219. share/doc/qt5/gammaray-manual/images/gammaray-object-inspector.png
  220. share/doc/qt5/gammaray-manual/images/gammaray-paint-analyzer.png
  221. share/doc/qt5/gammaray-manual/images/gammaray-properties.png
  222. share/doc/qt5/gammaray-manual/images/gammaray-qmlcontext.png
  223. share/doc/qt5/gammaray-manual/images/gammaray-qmltype.png
  224. share/doc/qt5/gammaray-manual/images/gammaray-qq2-geometry.png
  225. share/doc/qt5/gammaray-manual/images/gammaray-qq2-inspector.png
  226. share/doc/qt5/gammaray-manual/images/gammaray-qq2-qsg-visualize.png
  227. share/doc/qt5/gammaray-manual/images/gammaray-qqpainteditem-paint-analyzer.png
  228. share/doc/qt5/gammaray-manual/images/gammaray-qrc-browser.png
  229. share/doc/qt5/gammaray-manual/images/gammaray-qsggeometry.png
  230. share/doc/qt5/gammaray-manual/images/gammaray-qsgmaterial.png
  231. share/doc/qt5/gammaray-manual/images/gammaray-qsgtexture.png
  232. share/doc/qt5/gammaray-manual/images/gammaray-qsm-debugger.png
  233. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-buffers.png
  234. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-backface-culling.png
  235. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-buffers.png
  236. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-diagnostic-shading.png
  237. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-normals.png
  238. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry-wireframe.png
  239. share/doc/qt5/gammaray-manual/images/gammaray-qt3d-geometry.png
  240. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator-attach.png
  241. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator-connect.png
  242. share/doc/qt5/gammaray-manual/images/gammaray-qtcreator.png
  243. share/doc/qt5/gammaray-manual/images/gammaray-signal-plotter.png
  244. share/doc/qt5/gammaray-manual/images/gammaray-stack-trace.png
  245. share/doc/qt5/gammaray-manual/images/gammaray-standard-paths.png
  246. share/doc/qt5/gammaray-manual/images/gammaray-style-controls.png
  247. share/doc/qt5/gammaray-manual/images/gammaray-text-documents.png
  248. share/doc/qt5/gammaray-manual/images/gammaray-timertop.png
  249. share/doc/qt5/gammaray-manual/images/gammaray-timezones.png
  250. share/doc/qt5/gammaray-manual/images/gammaray-translations.png
  251. share/doc/qt5/gammaray-manual/images/gammaray-wayland-compositor.png
  252. share/doc/qt5/gammaray-manual/images/gammaray-web-inspector.png
  253. share/doc/qt5/gammaray-manual/images/gammaray-widget-attributes.png
  254. share/doc/qt5/gammaray-manual/images/gammaray-widget-inspector.png
  255. share/doc/qt5/gammaray-manual/index.html
  256. share/doc/qt5/qdoc.qch
  257. share/doc/qt5/qdoc/01-qdoc-manual.html
  258. share/doc/qt5/qdoc/03-qdoc-commands-markup.html
  259. share/doc/qt5/qdoc/04-qdoc-commands-textmarkup.html
  260. share/doc/qt5/qdoc/05-qdoc-commands-documentstructure.html
  261. share/doc/qt5/qdoc/06-qdoc-commands-includecodeinline.html
  262. share/doc/qt5/qdoc/07-0-qdoc-commands-includingexternalcode.html
  263. share/doc/qt5/qdoc/08-qdoc-commands-creatinglinks.html
  264. share/doc/qt5/qdoc/09-qdoc-commands-includingimages.html
  265. share/doc/qt5/qdoc/10-qdoc-commands-tablesandlists.html
  266. share/doc/qt5/qdoc/11-qdoc-commands-specialcontent.html
  267. share/doc/qt5/qdoc/12-0-qdoc-commands-miscellaneous.html
  268. share/doc/qt5/qdoc/13-qdoc-commands-topics.html
  269. share/doc/qt5/qdoc/14-qdoc-commands-contextcommands.html
  270. share/doc/qt5/qdoc/15-qdoc-commands-navigation.html
  271. share/doc/qt5/qdoc/16-qdoc-commands-status.html
  272. share/doc/qt5/qdoc/17-qdoc-commands-thread.html
  273. share/doc/qt5/qdoc/18-qdoc-commands-relating.html
  274. share/doc/qt5/qdoc/19-qdoc-commands-grouping.html
  275. share/doc/qt5/qdoc/20-qdoc-commands-namingthings.html
  276. share/doc/qt5/qdoc/21-0-qdoc-configuration.html
  277. share/doc/qt5/qdoc/21-0-qdoc-creating-dita-maps.html
  278. share/doc/qt5/qdoc/21-1-minimum-qdocconf.html
  279. share/doc/qt5/qdoc/21-2-qtgui-qdocconf.html
  280. share/doc/qt5/qdoc/21-3-qt-dita-xml-output.html
  281. share/doc/qt5/qdoc/22-creating-help-project-files.html
  282. share/doc/qt5/qdoc/22-qdoc-configuration-generalvariables.html
  283. share/doc/qt5/qdoc/23-qdoc-configuration-cppvariables.html
  284. share/doc/qt5/qdoc/24-qdoc-configuration-htmlvariables.html
  285. share/doc/qt5/qdoc/25-qdoc-configuration-derivedprojects.html
  286. share/doc/qt5/qdoc/26-qdoc-configuration-example-manifest-files.html
  287. share/doc/qt5/qdoc/27-qdoc-commands-alphabetical.html
  288. share/doc/qt5/qdoc/28-qdoc-qa-pages.html
  289. share/doc/qt5/qdoc/corefeatures.html
  290. share/doc/qt5/qdoc/images/arrow_bc.png
  291. share/doc/qt5/qdoc/images/bgrContent.png
  292. share/doc/qt5/qdoc/images/btn_next.png
  293. share/doc/qt5/qdoc/images/btn_prev.png
  294. share/doc/qt5/qdoc/images/bullet_dn.png
  295. share/doc/qt5/qdoc/images/bullet_sq.png
  296. share/doc/qt5/qdoc/images/happy.gif
  297. share/doc/qt5/qdoc/images/happyguy.jpg
  298. share/doc/qt5/qdoc/images/home.png
  299. share/doc/qt5/qdoc/images/ico_note.png
  300. share/doc/qt5/qdoc/images/ico_note_attention.png
  301. share/doc/qt5/qdoc/images/ico_out.png
  302. share/doc/qt5/qdoc/images/link-to-qquickitem.png
  303. share/doc/qt5/qdoc/images/links-to-links.png
  304. share/doc/qt5/qdoc/images/logo.png
  305. share/doc/qt5/qdoc/images/qa-table.png
  306. share/doc/qt5/qdoc/images/training.jpg
  307. share/doc/qt5/qdoc/images/windowsvista-pushbutton.png
  308. share/doc/qt5/qdoc/qdoc-categories.html
  309. share/doc/qt5/qdoc/qdoc-guide-clang.html
  310. share/doc/qt5/qdoc/qdoc-guide-conf.html
  311. share/doc/qt5/qdoc/qdoc-guide-writing.html
  312. share/doc/qt5/qdoc/qdoc-guide.html
  313. share/doc/qt5/qdoc/qdoc-index.html
  314. share/doc/qt5/qdoc/qdoc-minimum-qdocconf.html
  315. share/doc/qt5/qdoc/qdoc.index
  316. share/doc/qt5/qdoc/qdoc.qhp
  317. share/doc/qt5/qdoc/qdoc.qhp.sha1
  318. share/doc/qt5/qdoc/qdoc.tags
  319. share/doc/qt5/qdoc/qtgui-qdocconf.html
  320. share/doc/qt5/qdoc/qtwritingstyle-cpp.html
  321. share/doc/qt5/qdoc/qtwritingstyle-qml.html
  322. share/doc/qt5/qdoc/style/offline-simple.css
  323. share/doc/qt5/qdoc/style/offline.css
  324. share/doc/qt5/qmake.qch
  325. share/doc/qt5/qmake/images/arrow_bc.png
  326. share/doc/qt5/qmake/images/bgrContent.png
  327. share/doc/qt5/qmake/images/btn_next.png
  328. share/doc/qt5/qmake/images/btn_prev.png
  329. share/doc/qt5/qmake/images/bullet_dn.png
  330. share/doc/qt5/qmake/images/bullet_sq.png
  331. share/doc/qt5/qmake/images/home.png
  332. share/doc/qt5/qmake/images/ico_note.png
  333. share/doc/qt5/qmake/images/ico_note_attention.png
  334. share/doc/qt5/qmake/images/ico_out.png
  335. share/doc/qt5/qmake/images/logo.png
  336. share/doc/qt5/qmake/images/qmake-precompile-ui.png
  337. share/doc/qt5/qmake/qmake-advanced-usage.html
  338. share/doc/qt5/qmake/qmake-common-projects.html
  339. share/doc/qt5/qmake/qmake-environment-reference.html
  340. share/doc/qt5/qmake/qmake-function-reference.html
  341. share/doc/qt5/qmake/qmake-language.html
  342. share/doc/qt5/qmake/qmake-manual.html
  343. share/doc/qt5/qmake/qmake-overview.html
  344. share/doc/qt5/qmake/qmake-platform-notes.html
  345. share/doc/qt5/qmake/qmake-precompiledheaders.html
  346. share/doc/qt5/qmake/qmake-project-files.html
  347. share/doc/qt5/qmake/qmake-reference.html
  348. share/doc/qt5/qmake/qmake-running.html
  349. share/doc/qt5/qmake/qmake-test-function-reference.html
  350. share/doc/qt5/qmake/qmake-tutorial.html
  351. share/doc/qt5/qmake/qmake-variable-reference.html
  352. share/doc/qt5/qmake/qmake.index
  353. share/doc/qt5/qmake/qmake.qhp
  354. share/doc/qt5/qmake/qmake.qhp.sha1
  355. share/doc/qt5/qmake/style/offline-simple.css
  356. share/doc/qt5/qmake/style/offline.css
  357. share/doc/qt5/qt3d.qch
  358. share/doc/qt5/qt3d/examples-manifest.xml
  359. share/doc/qt5/qt3d/images/Space-invaders.jpg
  360. share/doc/qt5/qt3d/images/advanced-custom-material.jpg
  361. share/doc/qt5/qt3d/images/arrow_bc.png
  362. share/doc/qt5/qt3d/images/audio-visualizer-qml-example.png
  363. share/doc/qt5/qt3d/images/basicshapes-cpp-example.jpg
  364. share/doc/qt5/qt3d/images/bgrContent.png
  365. share/doc/qt5/qt3d/images/btn_next.png
  366. share/doc/qt5/qt3d/images/btn_prev.png
  367. share/doc/qt5/qt3d/images/bullet_dn.png
  368. share/doc/qt5/qt3d/images/bullet_sq.png
  369. share/doc/qt5/qt3d/images/deferred-framegraph.png
  370. share/doc/qt5/qt3d/images/ecs-1.png
  371. share/doc/qt5/qt3d/images/ecs-2.png
  372. share/doc/qt5/qt3d/images/framegraph-parallel-build.png
  373. share/doc/qt5/qt3d/images/home.png
  374. share/doc/qt5/qt3d/images/ico_note.png
  375. share/doc/qt5/qt3d/images/ico_note_attention.png
  376. share/doc/qt5/qt3d/images/ico_out.png
  377. share/doc/qt5/qt3d/images/logo.png
  378. share/doc/qt5/qt3d/images/multiviewport-1.png
  379. share/doc/qt5/qt3d/images/multiviewport-2.png
  380. share/doc/qt5/qt3d/images/multiviewport-qml-example.jpg
  381. share/doc/qt5/qt3d/images/multiviewport.png
  382. share/doc/qt5/qt3d/images/pbr-materials.png
  383. share/doc/qt5/qt3d/images/planets-qml-example.jpg
  384. share/doc/qt5/qt3d/images/qt3d-wireframe-rendering.png
  385. share/doc/qt5/qt3d/images/scene2d.png
  386. share/doc/qt5/qt3d/images/scene3d.png
  387. share/doc/qt5/qt3d/images/shadowmapping-depth.png
  388. share/doc/qt5/qt3d/images/shadowmapping-qt3d.png
  389. share/doc/qt5/qt3d/images/simple-cpp.png
  390. share/doc/qt5/qt3d/images/simple-custom-material.jpg
  391. share/doc/qt5/qt3d/images/simple-framegraph.png
  392. share/doc/qt5/qt3d/images/simple-qml.png
  393. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterDiffuse.jpg
  394. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterNormal.jpg
  395. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/WaterSpecular.jpg
  396. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/Waterwave.jpg
  397. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/foam.jpg
  398. share/doc/qt5/qt3d/images/used-in-examples/advancedcustommaterial/textures/sky.jpg
  399. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/albumcover.png
  400. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/demotitle.png
  401. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/normalmap.png
  402. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausehoverpressed.png
  403. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/pausenormal.png
  404. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playhoverpressed.png
  405. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/playnormal.png
  406. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/songtitle.png
  407. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopdisabled.png
  408. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stophoverpressed.png
  409. share/doc/qt5/qt3d/images/used-in-examples/audio-visualizer-qml/images/stopnormal.png
  410. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-hdpi/icon.png
  411. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-ldpi/icon.png
  412. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/android/res/drawable-mdpi/icon.png
  413. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/earth.png
  414. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/jupiter.png
  415. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mars.png
  416. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/mercury.png
  417. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/nasa/uranusringcolortrans.png
  418. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/neptune.png
  419. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/saturn.png
  420. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapcolortrans.png
  421. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthcloudmapspec.jpg
  422. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthmap2k.jpg
  423. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthnormal2k.jpg
  424. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/earthspec2k.jpg
  425. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/galaxy_starfield.jpg
  426. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/jupitermap.jpg
  427. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsmap2k.jpg
  428. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/marsnormal2k.jpg
  429. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurymap.jpg
  430. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/mercurynormal.jpg
  431. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonmap2k.jpg
  432. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/moonnormal2k.jpg
  433. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/neptunemap.jpg
  434. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnmap.jpg
  435. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/saturnringcolortrans.png
  436. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/sunmap.jpg
  437. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/uranusmap.jpg
  438. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusmap.jpg
  439. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/solarsystemscope/venusnormal.jpg
  440. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/sun.png
  441. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/uranus.png
  442. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/images/venus.png
  443. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient WatchKit App/Assets.xcassets/AppIcon.appiconset/home_icon.png
  444. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon120.png
  445. share/doc/qt5/qt3d/images/used-in-examples/planets-qml/planets-watchos/PlanetsClient/Assets.xcassets/AppIcon.appiconset/icon180.png
  446. share/doc/qt5/qt3d/images/wave.png
  447. share/doc/qt5/qt3d/images/widgets-scene3d.png
  448. share/doc/qt5/qt3d/qml-computecommand-members.html
  449. share/doc/qt5/qt3d/qml-computecommand.html
  450. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation-members.html
  451. share/doc/qt5/qt3d/qml-qt3d-animation-abstractanimation.html
  452. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
  453. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipanimator.html
  454. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
  455. share/doc/qt5/qt3d/qml-qt3d-animation-abstractclipblendnode.html
  456. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend-members.html
  457. share/doc/qt5/qt3d/qml-qt3d-animation-additiveclipblend.html
  458. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller-members.html
  459. share/doc/qt5/qt3d/qml-qt3d-animation-animationcontroller.html
  460. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup-members.html
  461. share/doc/qt5/qt3d/qml-qt3d-animation-animationgroup.html
  462. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
  463. share/doc/qt5/qt3d/qml-qt3d-animation-blendedclipanimator.html
  464. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator-members.html
  465. share/doc/qt5/qt3d/qml-qt3d-animation-clipanimator.html
  466. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation-members.html
  467. share/doc/qt5/qt3d/qml-qt3d-animation-keyframeanimation.html
  468. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend-members.html
  469. share/doc/qt5/qt3d/qml-qt3d-animation-lerpblend.html
  470. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation-members.html
  471. share/doc/qt5/qt3d/qml-qt3d-animation-morphinganimation.html
  472. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget-members.html
  473. share/doc/qt5/qt3d/qml-qt3d-animation-morphtarget.html
  474. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
  475. share/doc/qt5/qt3d/qml-qt3d-animation-vertexblendanimation.html
  476. share/doc/qt5/qt3d/qml-qt3d-core-abstractskeleton-members.html
  477. share/doc/qt5/qt3d/qml-qt3d-core-abstractskeleton.html
  478. share/doc/qt5/qt3d/qml-qt3d-core-armature-members.html
  479. share/doc/qt5/qt3d/qml-qt3d-core-armature.html
  480. share/doc/qt5/qt3d/qml-qt3d-core-component3d-members.html
  481. share/doc/qt5/qt3d/qml-qt3d-core-component3d.html
  482. share/doc/qt5/qt3d/qml-qt3d-core-entity-members.html
  483. share/doc/qt5/qt3d/qml-qt3d-core-entity.html
  484. share/doc/qt5/qt3d/qml-qt3d-core-entityloader-members.html
  485. share/doc/qt5/qt3d/qml-qt3d-core-entityloader.html
  486. share/doc/qt5/qt3d/qml-qt3d-core-joint-members.html
  487. share/doc/qt5/qt3d/qml-qt3d-core-joint.html
  488. share/doc/qt5/qt3d/qml-qt3d-core-node-members.html
  489. share/doc/qt5/qt3d/qml-qt3d-core-node.html
  490. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator-members.html
  491. share/doc/qt5/qt3d/qml-qt3d-core-nodeinstantiator.html
  492. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation-members.html
  493. share/doc/qt5/qt3d/qml-qt3d-core-quaternionanimation.html
  494. share/doc/qt5/qt3d/qml-qt3d-core-skeleton-members.html
  495. share/doc/qt5/qt3d/qml-qt3d-core-skeleton.html
  496. share/doc/qt5/qt3d/qml-qt3d-core-skeletonloader-members.html
  497. share/doc/qt5/qt3d/qml-qt3d-core-skeletonloader.html
  498. share/doc/qt5/qt3d/qml-qt3d-core-transform-members.html
  499. share/doc/qt5/qt3d/qml-qt3d-core-transform.html
  500. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry-members.html
  501. share/doc/qt5/qt3d/qml-qt3d-extras-conegeometry.html
  502. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh-members.html
  503. share/doc/qt5/qt3d/qml-qt3d-extras-conemesh.html
  504. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
  505. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidgeometry.html
  506. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh-members.html
  507. share/doc/qt5/qt3d/qml-qt3d-extras-cuboidmesh.html
  508. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry-members.html
  509. share/doc/qt5/qt3d/qml-qt3d-extras-cylindergeometry.html
  510. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh-members.html
  511. share/doc/qt5/qt3d/qml-qt3d-extras-cylindermesh.html
  512. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
  513. share/doc/qt5/qt3d/qml-qt3d-extras-diffusemapmaterial.html
  514. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
  515. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
  516. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmaterial-members.html
  517. share/doc/qt5/qt3d/qml-qt3d-extras-diffusespecularmaterial.html
  518. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
  519. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
  520. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
  521. share/doc/qt5/qt3d/qml-qt3d-extras-extrudedtextmesh.html
  522. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
  523. share/doc/qt5/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
  524. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-members.html
  525. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
  526. share/doc/qt5/qt3d/qml-qt3d-extras-forwardrenderer.html
  527. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial-members.html
  528. share/doc/qt5/qt3d/qml-qt3d-extras-goochmaterial.html
  529. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
  530. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
  531. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
  532. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
  533. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
  534. share/doc/qt5/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
  535. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
  536. share/doc/qt5/qt3d/qml-qt3d-extras-orbitcameracontroller.html
  537. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
  538. share/doc/qt5/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
  539. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
  540. share/doc/qt5/qt3d/qml-qt3d-extras-phongalphamaterial.html
  541. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial-members.html
  542. share/doc/qt5/qt3d/qml-qt3d-extras-phongmaterial.html
  543. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry-members.html
  544. share/doc/qt5/qt3d/qml-qt3d-extras-planegeometry.html
  545. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh-members.html
  546. share/doc/qt5/qt3d/qml-qt3d-extras-planemesh.html
  547. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry-members.html
  548. share/doc/qt5/qt3d/qml-qt3d-extras-spheregeometry.html
  549. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh-members.html
  550. share/doc/qt5/qt3d/qml-qt3d-extras-spheremesh.html
  551. share/doc/qt5/qt3d/qml-qt3d-extras-text2dentity-members.html
  552. share/doc/qt5/qt3d/qml-qt3d-extras-text2dentity.html
  553. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry-members.html
  554. share/doc/qt5/qt3d/qml-qt3d-extras-torusgeometry.html
  555. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh-members.html
  556. share/doc/qt5/qt3d/qml-qt3d-extras-torusmesh.html
  557. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput-members.html
  558. share/doc/qt5/qt3d/qml-qt3d-input-abstractactioninput.html
  559. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput-members.html
  560. share/doc/qt5/qt3d/qml-qt3d-input-abstractaxisinput.html
  561. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
  562. share/doc/qt5/qt3d/qml-qt3d-input-abstractphysicaldevice.html
  563. share/doc/qt5/qt3d/qml-qt3d-input-action-members.html
  564. share/doc/qt5/qt3d/qml-qt3d-input-action.html
  565. share/doc/qt5/qt3d/qml-qt3d-input-actioninput-members.html
  566. share/doc/qt5/qt3d/qml-qt3d-input-actioninput.html
  567. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput-members.html
  568. share/doc/qt5/qt3d/qml-qt3d-input-analogaxisinput.html
  569. share/doc/qt5/qt3d/qml-qt3d-input-axis-members.html
  570. share/doc/qt5/qt3d/qml-qt3d-input-axis.html
  571. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator-members.html
  572. share/doc/qt5/qt3d/qml-qt3d-input-axisaccumulator.html
  573. share/doc/qt5/qt3d/qml-qt3d-input-axissetting-members.html
  574. share/doc/qt5/qt3d/qml-qt3d-input-axissetting.html
  575. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput-members.html
  576. share/doc/qt5/qt3d/qml-qt3d-input-buttonaxisinput.html
  577. share/doc/qt5/qt3d/qml-qt3d-input-inputchord-members.html
  578. share/doc/qt5/qt3d/qml-qt3d-input-inputchord.html
  579. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence-members.html
  580. share/doc/qt5/qt3d/qml-qt3d-input-inputsequence.html
  581. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings-members.html
  582. share/doc/qt5/qt3d/qml-qt3d-input-inputsettings.html
  583. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice-members.html
  584. share/doc/qt5/qt3d/qml-qt3d-input-keyboarddevice.html
  585. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler-members.html
  586. share/doc/qt5/qt3d/qml-qt3d-input-keyboardhandler.html
  587. share/doc/qt5/qt3d/qml-qt3d-input-keyevent-members.html
  588. share/doc/qt5/qt3d/qml-qt3d-input-keyevent.html
  589. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice-members.html
  590. share/doc/qt5/qt3d/qml-qt3d-input-logicaldevice.html
  591. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice-members.html
  592. share/doc/qt5/qt3d/qml-qt3d-input-mousedevice.html
  593. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent-members.html
  594. share/doc/qt5/qt3d/qml-qt3d-input-mouseevent.html
  595. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler-members.html
  596. share/doc/qt5/qt3d/qml-qt3d-input-mousehandler.html
  597. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent-members.html
  598. share/doc/qt5/qt3d/qml-qt3d-input-wheelevent.html
  599. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction-members.html
  600. share/doc/qt5/qt3d/qml-qt3d-logic-frameaction.html
  601. share/doc/qt5/qt3d/qml-qt3d-render-abstractraycaster-members.html
  602. share/doc/qt5/qt3d/qml-qt3d-render-abstractraycaster.html
  603. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage-members.html
  604. share/doc/qt5/qt3d/qml-qt3d-render-abstracttextureimage.html
  605. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage-members.html
  606. share/doc/qt5/qt3d/qml-qt3d-render-alphacoverage.html
  607. share/doc/qt5/qt3d/qml-qt3d-render-alphatest-members.html
  608. share/doc/qt5/qt3d/qml-qt3d-render-alphatest.html
  609. share/doc/qt5/qt3d/qml-qt3d-render-attribute-members.html
  610. share/doc/qt5/qt3d/qml-qt3d-render-attribute.html
  611. share/doc/qt5/qt3d/qml-qt3d-render-blendequation-members.html
  612. share/doc/qt5/qt3d/qml-qt3d-render-blendequation.html
  613. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments-members.html
  614. share/doc/qt5/qt3d/qml-qt3d-render-blendequationarguments.html
  615. share/doc/qt5/qt3d/qml-qt3d-render-blitframebuffer-members.html
  616. share/doc/qt5/qt3d/qml-qt3d-render-blitframebuffer.html
  617. share/doc/qt5/qt3d/qml-qt3d-render-buffer-members.html
  618. share/doc/qt5/qt3d/qml-qt3d-render-buffer-obsolete.html
  619. share/doc/qt5/qt3d/qml-qt3d-render-buffer.html
  620. share/doc/qt5/qt3d/qml-qt3d-render-camera-members.html
  621. share/doc/qt5/qt3d/qml-qt3d-render-camera-obsolete.html
  622. share/doc/qt5/qt3d/qml-qt3d-render-camera.html
  623. share/doc/qt5/qt3d/qml-qt3d-render-cameralens-members.html
  624. share/doc/qt5/qt3d/qml-qt3d-render-cameralens.html
  625. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector-members.html
  626. share/doc/qt5/qt3d/qml-qt3d-render-cameraselector.html
  627. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers-members.html
  628. share/doc/qt5/qt3d/qml-qt3d-render-clearbuffers.html
  629. share/doc/qt5/qt3d/qml-qt3d-render-clipplane-members.html
  630. share/doc/qt5/qt3d/qml-qt3d-render-clipplane.html
  631. share/doc/qt5/qt3d/qml-qt3d-render-colormask-members.html
  632. share/doc/qt5/qt3d/qml-qt3d-render-colormask.html
  633. share/doc/qt5/qt3d/qml-qt3d-render-cullface-members.html
  634. share/doc/qt5/qt3d/qml-qt3d-render-cullface.html
  635. share/doc/qt5/qt3d/qml-qt3d-render-depthtest-members.html
  636. share/doc/qt5/qt3d/qml-qt3d-render-depthtest.html
  637. share/doc/qt5/qt3d/qml-qt3d-render-directionallight-members.html
  638. share/doc/qt5/qt3d/qml-qt3d-render-directionallight.html
  639. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute-members.html
  640. share/doc/qt5/qt3d/qml-qt3d-render-dispatchcompute.html
  641. share/doc/qt5/qt3d/qml-qt3d-render-dithering-members.html
  642. share/doc/qt5/qt3d/qml-qt3d-render-dithering.html
  643. share/doc/qt5/qt3d/qml-qt3d-render-effect-members.html
  644. share/doc/qt5/qt3d/qml-qt3d-render-effect.html
  645. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight-members.html
  646. share/doc/qt5/qt3d/qml-qt3d-render-environmentlight.html
  647. share/doc/qt5/qt3d/qml-qt3d-render-filterkey-members.html
  648. share/doc/qt5/qt3d/qml-qt3d-render-filterkey.html
  649. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode-members.html
  650. share/doc/qt5/qt3d/qml-qt3d-render-framegraphnode.html
  651. share/doc/qt5/qt3d/qml-qt3d-render-frontface-members.html
  652. share/doc/qt5/qt3d/qml-qt3d-render-frontface.html
  653. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling-members.html
  654. share/doc/qt5/qt3d/qml-qt3d-render-frustumculling.html
  655. share/doc/qt5/qt3d/qml-qt3d-render-geometry-members.html
  656. share/doc/qt5/qt3d/qml-qt3d-render-geometry.html
  657. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer-members.html
  658. share/doc/qt5/qt3d/qml-qt3d-render-geometryrenderer.html
  659. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter-members.html
  660. share/doc/qt5/qt3d/qml-qt3d-render-graphicsapifilter.html
  661. share/doc/qt5/qt3d/qml-qt3d-render-layer-members.html
  662. share/doc/qt5/qt3d/qml-qt3d-render-layer.html
  663. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter-members.html
  664. share/doc/qt5/qt3d/qml-qt3d-render-layerfilter.html
  665. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail-members.html
  666. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetail.html
  667. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailboundingsphere-members.html
  668. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailboundingsphere.html
  669. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader-members.html
  670. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailloader.html
  671. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
  672. share/doc/qt5/qt3d/qml-qt3d-render-levelofdetailswitch.html
  673. share/doc/qt5/qt3d/qml-qt3d-render-light-members.html
  674. share/doc/qt5/qt3d/qml-qt3d-render-light.html
  675. share/doc/qt5/qt3d/qml-qt3d-render-linewidth-members.html
  676. share/doc/qt5/qt3d/qml-qt3d-render-linewidth.html
  677. share/doc/qt5/qt3d/qml-qt3d-render-material-members.html
  678. share/doc/qt5/qt3d/qml-qt3d-render-material.html
  679. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier-members.html
  680. share/doc/qt5/qt3d/qml-qt3d-render-memorybarrier.html
  681. share/doc/qt5/qt3d/qml-qt3d-render-mesh-members.html
  682. share/doc/qt5/qt3d/qml-qt3d-render-mesh.html
  683. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
  684. share/doc/qt5/qt3d/qml-qt3d-render-multisampleantialiasing.html
  685. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask-members.html
  686. share/doc/qt5/qt3d/qml-qt3d-render-nodepthmask.html
  687. share/doc/qt5/qt3d/qml-qt3d-render-nodraw-members.html
  688. share/doc/qt5/qt3d/qml-qt3d-render-nodraw.html
  689. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker-members.html
  690. share/doc/qt5/qt3d/qml-qt3d-render-objectpicker.html
  691. share/doc/qt5/qt3d/qml-qt3d-render-parameter-members.html
  692. share/doc/qt5/qt3d/qml-qt3d-render-parameter.html
  693. share/doc/qt5/qt3d/qml-qt3d-render-pickevent-members.html
  694. share/doc/qt5/qt3d/qml-qt3d-render-pickevent.html
  695. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings-members.html
  696. share/doc/qt5/qt3d/qml-qt3d-render-pickingsettings.html
  697. share/doc/qt5/qt3d/qml-qt3d-render-picklineevent-members.html
  698. share/doc/qt5/qt3d/qml-qt3d-render-picklineevent.html
  699. share/doc/qt5/qt3d/qml-qt3d-render-pickpointevent-members.html
  700. share/doc/qt5/qt3d/qml-qt3d-render-pickpointevent.html
  701. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent-members.html
  702. share/doc/qt5/qt3d/qml-qt3d-render-picktriangleevent.html
  703. share/doc/qt5/qt3d/qml-qt3d-render-pointlight-members.html
  704. share/doc/qt5/qt3d/qml-qt3d-render-pointlight.html
  705. share/doc/qt5/qt3d/qml-qt3d-render-pointsize-members.html
  706. share/doc/qt5/qt3d/qml-qt3d-render-pointsize.html
  707. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset-members.html
  708. share/doc/qt5/qt3d/qml-qt3d-render-polygonoffset.html
  709. share/doc/qt5/qt3d/qml-qt3d-render-proximityfilter-members.html
  710. share/doc/qt5/qt3d/qml-qt3d-render-proximityfilter.html
  711. share/doc/qt5/qt3d/qml-qt3d-render-raycaster-members.html
  712. share/doc/qt5/qt3d/qml-qt3d-render-raycaster.html
  713. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-members.html
  714. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture-obsolete.html
  715. share/doc/qt5/qt3d/qml-qt3d-render-rendercapture.html
  716. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-members.html
  717. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply-obsolete.html
  718. share/doc/qt5/qt3d/qml-qt3d-render-rendercapturereply.html
  719. share/doc/qt5/qt3d/qml-qt3d-render-renderpass-members.html
  720. share/doc/qt5/qt3d/qml-qt3d-render-renderpass.html
  721. share/doc/qt5/qt3d/qml-qt3d-render-renderpassfilter-members.html
  722. share/doc/qt5/qt3d/qml-qt3d-render-renderpassfilter.html
  723. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings-members.html
  724. share/doc/qt5/qt3d/qml-qt3d-render-rendersettings.html
  725. share/doc/qt5/qt3d/qml-qt3d-render-renderstateset-members.html
  726. share/doc/qt5/qt3d/qml-qt3d-render-renderstateset.html
  727. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
  728. share/doc/qt5/qt3d/qml-qt3d-render-rendersurfaceselector.html
  729. share/doc/qt5/qt3d/qml-qt3d-render-rendertarget-members.html
  730. share/doc/qt5/qt3d/qml-qt3d-render-rendertarget.html
  731. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetoutput-members.html
  732. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetoutput.html
  733. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector-members.html
  734. share/doc/qt5/qt3d/qml-qt3d-render-rendertargetselector.html
  735. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader-members.html
  736. share/doc/qt5/qt3d/qml-qt3d-render-sceneloader.html
  737. share/doc/qt5/qt3d/qml-qt3d-render-scissortest-members.html
  738. share/doc/qt5/qt3d/qml-qt3d-render-scissortest.html
  739. share/doc/qt5/qt3d/qml-qt3d-render-screenraycaster-members.html
  740. share/doc/qt5/qt3d/qml-qt3d-render-screenraycaster.html
  741. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap-members.html
  742. share/doc/qt5/qt3d/qml-qt3d-render-seamlesscubemap.html
  743. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram-members.html
  744. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogram.html
  745. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogrambuilder-members.html
  746. share/doc/qt5/qt3d/qml-qt3d-render-shaderprogrambuilder.html
  747. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy-members.html
  748. share/doc/qt5/qt3d/qml-qt3d-render-sortpolicy.html
  749. share/doc/qt5/qt3d/qml-qt3d-render-spotlight-members.html
  750. share/doc/qt5/qt3d/qml-qt3d-render-spotlight.html
  751. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask-members.html
  752. share/doc/qt5/qt3d/qml-qt3d-render-stencilmask.html
  753. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation-members.html
  754. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperation.html
  755. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
  756. share/doc/qt5/qt3d/qml-qt3d-render-stenciloperationarguments.html
  757. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest-members.html
  758. share/doc/qt5/qt3d/qml-qt3d-render-stenciltest.html
  759. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments-members.html
  760. share/doc/qt5/qt3d/qml-qt3d-render-stenciltestarguments.html
  761. share/doc/qt5/qt3d/qml-qt3d-render-technique-members.html
  762. share/doc/qt5/qt3d/qml-qt3d-render-technique.html
  763. share/doc/qt5/qt3d/qml-qt3d-render-techniquefilter-members.html
  764. share/doc/qt5/qt3d/qml-qt3d-render-techniquefilter.html
  765. share/doc/qt5/qt3d/qml-qt3d-render-textureimage-members.html
  766. share/doc/qt5/qt3d/qml-qt3d-render-textureimage.html
  767. share/doc/qt5/qt3d/qml-qt3d-render-viewport-members.html
  768. share/doc/qt5/qt3d/qml-qt3d-render-viewport.html
  769. share/doc/qt5/qt3d/qml-qtquick-scene2d-scene2d-members.html
  770. share/doc/qt5/qt3d/qml-qtquick-scene2d-scene2d.html
  771. share/doc/qt5/qt3d/qml-qtquick-scene3d-scene3d-members.html
  772. share/doc/qt5/qt3d/qml-qtquick-scene3d-scene3d.html
  773. share/doc/qt5/qt3d/qml-renderstate-members.html
  774. share/doc/qt5/qt3d/qml-renderstate.html
  775. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-advancedcustommaterial-pro.html
  776. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-example.html
  777. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-cpp.html
  778. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-main-qml.html
  779. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-models-qrc.html
  780. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-qml-qrc.html
  781. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-sceneroot-qml.html
  782. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-es2-water-vert.html
  783. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-gl3-water-vert.html
  784. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-shaders-qrc.html
  785. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-textures-qrc.html
  786. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-water-qml.html
  787. share/doc/qt5/qt3d/qt3d-advancedcustommaterial-watermaterial-qml.html
  788. share/doc/qt5/qt3d/qt3d-animation-qmlmodule.html
  789. share/doc/qt5/qt3d/qt3d-attribution-assimp.html
  790. share/doc/qt5/qt3d/qt3d-attribution-gltf-wine.html
  791. share/doc/qt5/qt3d/qt3d-attribution-miramar-sky.html
  792. share/doc/qt5/qt3d/qt3d-attribution-nasa-jpl.html
  793. share/doc/qt5/qt3d/qt3d-attribution-solar-system-scope.html
  794. share/doc/qt5/qt3d/qt3d-attribution-substance-share.html
  795. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-pro.html
  796. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-audio-visualizer-qml-qrc.html
  797. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-barentity-qml.html
  798. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-example.html
  799. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-cpp.html
  800. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-main-qml.html
  801. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-cpp.html
  802. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-touchsettings-h.html
  803. share/doc/qt5/qt3d/qt3d-audio-visualizer-qml-visualizer-qml.html
  804. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-basicshapes-cpp-pro.html
  805. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-example.html
  806. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-main-cpp.html
  807. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-cpp.html
  808. share/doc/qt5/qt3d/qt3d-basicshapes-cpp-scenemodifier-h.html
  809. share/doc/qt5/qt3d/qt3d-core-qmlmodule.html
  810. share/doc/qt5/qt3d/qt3d-cpp.html
  811. share/doc/qt5/qt3d/qt3d-examples.html
  812. share/doc/qt5/qt3d/qt3d-extras-qmlmodule.html
  813. share/doc/qt5/qt3d/qt3d-index.html
  814. share/doc/qt5/qt3d/qt3d-input-qmlmodule.html
  815. share/doc/qt5/qt3d/qt3d-logic-qmlmodule.html
  816. share/doc/qt5/qt3d/qt3d-multiviewport-example.html
  817. share/doc/qt5/qt3d/qt3d-multiviewport-main-cpp.html
  818. share/doc/qt5/qt3d/qt3d-multiviewport-main-qml.html
  819. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-pro.html
  820. share/doc/qt5/qt3d/qt3d-multiviewport-multiviewport-qrc.html
  821. share/doc/qt5/qt3d/qt3d-multiviewport-quadviewportframegraph-qml.html
  822. share/doc/qt5/qt3d/qt3d-multiviewport-simplecamera-qml.html
  823. share/doc/qt5/qt3d/qt3d-overview.html
  824. share/doc/qt5/qt3d/qt3d-pbr-materials-basiccamera-qml.html
  825. share/doc/qt5/qt3d/qt3d-pbr-materials-example.html
  826. share/doc/qt5/qt3d/qt3d-pbr-materials-lights-qml.html
  827. share/doc/qt5/qt3d/qt3d-pbr-materials-main-cpp.html
  828. share/doc/qt5/qt3d/qt3d-pbr-materials-main-qml.html
  829. share/doc/qt5/qt3d/qt3d-pbr-materials-materials-qrc.html
  830. share/doc/qt5/qt3d/qt3d-pbr-materials-pbr-materials-pro.html
  831. share/doc/qt5/qt3d/qt3d-pbr-materials-trefoilknot-qml.html
  832. share/doc/qt5/qt3d/qt3d-planets-qml-android-androidmanifest-xml.html
  833. share/doc/qt5/qt3d/qt3d-planets-qml-appletvinput-qml.html
  834. share/doc/qt5/qt3d/qt3d-planets-qml-example.html
  835. share/doc/qt5/qt3d/qt3d-planets-qml-fpsdisplay-qml.html
  836. share/doc/qt5/qt3d/qt3d-planets-qml-infosheet-qml.html
  837. share/doc/qt5/qt3d/qt3d-planets-qml-main-cpp.html
  838. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-cpp.html
  839. share/doc/qt5/qt3d/qt3d-planets-qml-networkcontroller-h.html
  840. share/doc/qt5/qt3d/qt3d-planets-qml-planet-qml.html
  841. share/doc/qt5/qt3d/qt3d-planets-qml-planetbutton-qml.html
  842. share/doc/qt5/qt3d/qt3d-planets-qml-planeteffect-qml.html
  843. share/doc/qt5/qt3d/qt3d-planets-qml-planetframegraph-qml.html
  844. share/doc/qt5/qt3d/qt3d-planets-qml-planetmaterial-qml.html
  845. share/doc/qt5/qt3d/qt3d-planets-qml-planets-js.html
  846. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-images-qrc.html
  847. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-pro.html
  848. share/doc/qt5/qt3d/qt3d-planets-qml-planets-qml-qrc.html
  849. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-appdelegate-h.html
  850. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-viewcontroller-h.html
  851. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-extensiondelegate-h.html
  852. share/doc/qt5/qt3d/qt3d-planets-qml-planets-watchos-planetsclient-watchkit-extension-interfacecontroller-h.html
  853. share/doc/qt5/qt3d/qt3d-planets-qml-planetslight-qml.html
  854. share/doc/qt5/qt3d/qt3d-planets-qml-planetsmain-qml.html
  855. share/doc/qt5/qt3d/qt3d-planets-qml-ring-qml.html
  856. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetd-vert.html
  857. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-planetdb-vert.html
  858. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-es2-sun-vert.html
  859. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetd-vert.html
  860. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdb-vert.html
  861. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-planetdshadow-vert.html
  862. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-shadowmap-vert.html
  863. share/doc/qt5/qt3d/qt3d-planets-qml-shaders-gl3-sun-vert.html
  864. share/doc/qt5/qt3d/qt3d-planets-qml-shadoweffect-qml.html
  865. share/doc/qt5/qt3d/qt3d-planets-qml-solarsystem-qml.html
  866. share/doc/qt5/qt3d/qt3d-planets-qml-styledslider-qml.html
  867. share/doc/qt5/qt3d/qt3d-planets-qml-suneffect-qml.html
  868. share/doc/qt5/qt3d/qt3d-qml.html
  869. share/doc/qt5/qt3d/qt3d-render-qmlmodule.html
  870. share/doc/qt5/qt3d/qt3d-scene2d-example.html
  871. share/doc/qt5/qt3d/qt3d-scene2d-logocontrols-qml.html
  872. share/doc/qt5/qt3d/qt3d-scene2d-main-cpp.html
  873. share/doc/qt5/qt3d/qt3d-scene2d-main-qml.html
  874. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-pro.html
  875. share/doc/qt5/qt3d/qt3d-scene2d-scene2d-qrc.html
  876. share/doc/qt5/qt3d/qt3d-scene3d-animatedentity-qml.html
  877. share/doc/qt5/qt3d/qt3d-scene3d-example.html
  878. share/doc/qt5/qt3d/qt3d-scene3d-main-cpp.html
  879. share/doc/qt5/qt3d/qt3d-scene3d-main-qml.html
  880. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-pro.html
  881. share/doc/qt5/qt3d/qt3d-scene3d-scene3d-qrc.html
  882. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adseffect-qml.html
  883. share/doc/qt5/qt3d/qt3d-shadow-map-qml-adsmaterial-qml.html
  884. share/doc/qt5/qt3d/qt3d-shadow-map-qml-example.html
  885. share/doc/qt5/qt3d/qt3d-shadow-map-qml-groundplane-qml.html
  886. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-cpp.html
  887. share/doc/qt5/qt3d/qt3d-shadow-map-qml-main-qml.html
  888. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-ads-vert.html
  889. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-ads-vert.html
  890. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-es3-shadowmap-vert.html
  891. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shaders-shadowmap-vert.html
  892. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-pro.html
  893. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadow-map-qml-qrc.html
  894. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmapframegraph-qml.html
  895. share/doc/qt5/qt3d/qt3d-shadow-map-qml-shadowmaplight-qml.html
  896. share/doc/qt5/qt3d/qt3d-shadow-map-qml-toyplane-qml.html
  897. share/doc/qt5/qt3d/qt3d-shadow-map-qml-trefoil-qml.html
  898. share/doc/qt5/qt3d/qt3d-simple-cpp-example.html
  899. share/doc/qt5/qt3d/qt3d-simple-cpp-main-cpp.html
  900. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-cpp.html
  901. share/doc/qt5/qt3d/qt3d-simple-cpp-orbittransformcontroller-h.html
  902. share/doc/qt5/qt3d/qt3d-simple-cpp-simple-cpp-pro.html
  903. share/doc/qt5/qt3d/qt3d-simple-qml-example.html
  904. share/doc/qt5/qt3d/qt3d-simple-qml-main-cpp.html
  905. share/doc/qt5/qt3d/qt3d-simple-qml-main-qml.html
  906. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-pro.html
  907. share/doc/qt5/qt3d/qt3d-simple-qml-simple-qml-qrc.html
  908. share/doc/qt5/qt3d/qt3d-simplecustommaterial-example.html
  909. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-cpp.html
  910. share/doc/qt5/qt3d/qt3d-simplecustommaterial-main-qml.html
  911. share/doc/qt5/qt3d/qt3d-simplecustommaterial-models-qrc.html
  912. share/doc/qt5/qt3d/qt3d-simplecustommaterial-planemodel-qml.html
  913. share/doc/qt5/qt3d/qt3d-simplecustommaterial-qml-qrc.html
  914. share/doc/qt5/qt3d/qt3d-simplecustommaterial-sceneroot-qml.html
  915. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-es2-simplecolor-vert.html
  916. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-gl3-simplecolor-vert.html
  917. share/doc/qt5/qt3d/qt3d-simplecustommaterial-shaders-qrc.html
  918. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplecustommaterial-pro.html
  919. share/doc/qt5/qt3d/qt3d-simplecustommaterial-simplematerial-qml.html
  920. share/doc/qt5/qt3d/qt3d-simplecustommaterial-textures-qrc.html
  921. share/doc/qt5/qt3d/qt3d-wave-background-qml.html
  922. share/doc/qt5/qt3d/qt3d-wave-backgroundeffect-qml.html
  923. share/doc/qt5/qt3d/qt3d-wave-basiccamera-qml.html
  924. share/doc/qt5/qt3d/qt3d-wave-example.html
  925. share/doc/qt5/qt3d/qt3d-wave-main-cpp.html
  926. share/doc/qt5/qt3d/qt3d-wave-main-qml.html
  927. share/doc/qt5/qt3d/qt3d-wave-shaders-background-vert.html
  928. share/doc/qt5/qt3d/qt3d-wave-shaders-ribbon-vert.html
  929. share/doc/qt5/qt3d/qt3d-wave-shaders-robustwireframe-geom.html
  930. share/doc/qt5/qt3d/qt3d-wave-wave-pro.html
  931. share/doc/qt5/qt3d/qt3d-wave-wave-qml.html
  932. share/doc/qt5/qt3d/qt3d-wave-wave-qrc.html
  933. share/doc/qt5/qt3d/qt3d-wave-waveeffect-qml.html
  934. share/doc/qt5/qt3d/qt3d-wave-waveforwardrenderer-qml.html
  935. share/doc/qt5/qt3d/qt3d-wave-wavematerial-qml.html
  936. share/doc/qt5/qt3d/qt3d-widgets-scene3d-example.html
  937. share/doc/qt5/qt3d/qt3d-widgets-scene3d-main-cpp.html
  938. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-pro.html
  939. share/doc/qt5/qt3d/qt3d-widgets-scene3d-widgets-scene3d-qrc.html
  940. share/doc/qt5/qt3d/qt3d-wireframe-basiccamera-qml.html
  941. share/doc/qt5/qt3d/qt3d-wireframe-example.html
  942. share/doc/qt5/qt3d/qt3d-wireframe-main-cpp.html
  943. share/doc/qt5/qt3d/qt3d-wireframe-main-qml.html
  944. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-geom.html
  945. share/doc/qt5/qt3d/qt3d-wireframe-shaders-robustwireframe-vert.html
  946. share/doc/qt5/qt3d/qt3d-wireframe-trefoilknot-qml.html
  947. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-pro.html
  948. share/doc/qt5/qt3d/qt3d-wireframe-wireframe-qrc.html
  949. share/doc/qt5/qt3d/qt3d-wireframe-wireframeeffect-qml.html
  950. share/doc/qt5/qt3d/qt3d-wireframe-wireframematerial-qml.html
  951. share/doc/qt5/qt3d/qt3d.index
  952. share/doc/qt5/qt3d/qt3d.qhp
  953. share/doc/qt5/qt3d/qt3d.qhp.sha1
  954. share/doc/qt5/qt3d/qt3d.tags
  955. share/doc/qt5/qt3d/qt3danimation-module.html
  956. share/doc/qt5/qt3d/qt3danimation-qabstractanimation-members.html
  957. share/doc/qt5/qt3d/qt3danimation-qabstractanimation-obsolete.html
  958. share/doc/qt5/qt3d/qt3danimation-qabstractanimation.html
  959. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip-members.html
  960. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip-obsolete.html
  961. share/doc/qt5/qt3d/qt3danimation-qabstractanimationclip.html
  962. share/doc/qt5/qt3d/qt3danimation-qabstractchannelmapping-members.html
  963. share/doc/qt5/qt3d/qt3danimation-qabstractchannelmapping.html
  964. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator-members.html
  965. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator-obsolete.html
  966. share/doc/qt5/qt3d/qt3danimation-qabstractclipanimator.html
  967. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode-members.html
  968. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode-obsolete.html
  969. share/doc/qt5/qt3d/qt3danimation-qabstractclipblendnode.html
  970. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend-members.html
  971. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend-obsolete.html
  972. share/doc/qt5/qt3d/qt3danimation-qadditiveclipblend.html
  973. share/doc/qt5/qt3d/qt3danimation-qanimationaspect-members.html
  974. share/doc/qt5/qt3d/qt3danimation-qanimationaspect-obsolete.html
  975. share/doc/qt5/qt3d/qt3danimation-qanimationaspect.html
  976. share/doc/qt5/qt3d/qt3danimation-qanimationcallback-members.html
  977. share/doc/qt5/qt3d/qt3danimation-qanimationcallback.html
  978. share/doc/qt5/qt3d/qt3danimation-qanimationclip-members.html
  979. share/doc/qt5/qt3d/qt3danimation-qanimationclip-obsolete.html
  980. share/doc/qt5/qt3d/qt3danimation-qanimationclip.html
  981. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata-members.html
  982. share/doc/qt5/qt3d/qt3danimation-qanimationclipdata.html
  983. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader-members.html
  984. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader-obsolete.html
  985. share/doc/qt5/qt3d/qt3danimation-qanimationcliploader.html
  986. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller-members.html
  987. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller-obsolete.html
  988. share/doc/qt5/qt3d/qt3danimation-qanimationcontroller.html
  989. share/doc/qt5/qt3d/qt3danimation-qanimationgroup-members.html
  990. share/doc/qt5/qt3d/qt3danimation-qanimationgroup-obsolete.html
  991. share/doc/qt5/qt3d/qt3danimation-qanimationgroup.html
  992. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator-members.html
  993. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator-obsolete.html
  994. share/doc/qt5/qt3d/qt3danimation-qblendedclipanimator.html
  995. share/doc/qt5/qt3d/qt3danimation-qcallbackmapping-members.html
  996. share/doc/qt5/qt3d/qt3danimation-qcallbackmapping-obsolete.html
  997. share/doc/qt5/qt3d/qt3danimation-qcallbackmapping.html
  998. share/doc/qt5/qt3d/qt3danimation-qchannel-members.html
  999. share/doc/qt5/qt3d/qt3danimation-qchannel.html
  1000. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent-members.html
  1001. share/doc/qt5/qt3d/qt3danimation-qchannelcomponent.html
  1002. share/doc/qt5/qt3d/qt3danimation-qchannelmapper-members.html
  1003. share/doc/qt5/qt3d/qt3danimation-qchannelmapper-obsolete.html
  1004. share/doc/qt5/qt3d/qt3danimation-qchannelmapper.html
  1005. share/doc/qt5/qt3d/qt3danimation-qchannelmapping-members.html
  1006. share/doc/qt5/qt3d/qt3danimation-qchannelmapping-obsolete.html
  1007. share/doc/qt5/qt3d/qt3danimation-qchannelmapping.html
  1008. share/doc/qt5/qt3d/qt3danimation-qchannelmappingcreatedchange-members.html
  1009. share/doc/qt5/qt3d/qt3danimation-qchannelmappingcreatedchange.html
  1010. share/doc/qt5/qt3d/qt3danimation-qchannelmappingcreatedchangebase-members.html
  1011. share/doc/qt5/qt3d/qt3danimation-qchannelmappingcreatedchangebase.html
  1012. share/doc/qt5/qt3d/qt3danimation-qclipanimator-members.html
  1013. share/doc/qt5/qt3d/qt3danimation-qclipanimator-obsolete.html
  1014. share/doc/qt5/qt3d/qt3danimation-qclipanimator.html
  1015. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange-members.html
  1016. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchange.html
  1017. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase-members.html
  1018. share/doc/qt5/qt3d/qt3danimation-qclipblendnodecreatedchangebase.html
  1019. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue-members.html
  1020. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue-obsolete.html
  1021. share/doc/qt5/qt3d/qt3danimation-qclipblendvalue.html
  1022. share/doc/qt5/qt3d/qt3danimation-qclock-members.html
  1023. share/doc/qt5/qt3d/qt3danimation-qclock.html
  1024. share/doc/qt5/qt3d/qt3danimation-qkeyframe-members.html
  1025. share/doc/qt5/qt3d/qt3danimation-qkeyframe.html
  1026. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation-members.html
  1027. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation-obsolete.html
  1028. share/doc/qt5/qt3d/qt3danimation-qkeyframeanimation.html
  1029. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend-members.html
  1030. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend-obsolete.html
  1031. share/doc/qt5/qt3d/qt3danimation-qlerpclipblend.html
  1032. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation-members.html
  1033. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation-obsolete.html
  1034. share/doc/qt5/qt3d/qt3danimation-qmorphinganimation.html
  1035. share/doc/qt5/qt3d/qt3danimation-qmorphtarget-members.html
  1036. share/doc/qt5/qt3d/qt3danimation-qmorphtarget-obsolete.html
  1037. share/doc/qt5/qt3d/qt3danimation-qmorphtarget.html
  1038. share/doc/qt5/qt3d/qt3danimation-qskeletonmapping-members.html
  1039. share/doc/qt5/qt3d/qt3danimation-qskeletonmapping.html
  1040. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation-members.html
  1041. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation-obsolete.html
  1042. share/doc/qt5/qt3d/qt3danimation-qvertexblendanimation.html
  1043. share/doc/qt5/qt3d/qt3danimation.html
  1044. share/doc/qt5/qt3d/qt3dcore-module.html
  1045. share/doc/qt5/qt3d/qt3dcore-qabstractaspect-members.html
  1046. share/doc/qt5/qt3d/qt3dcore-qabstractaspect-obsolete.html
  1047. share/doc/qt5/qt3d/qt3dcore-qabstractaspect.html
  1048. share/doc/qt5/qt3d/qt3dcore-qabstractskeleton-members.html
  1049. share/doc/qt5/qt3d/qt3dcore-qabstractskeleton-obsolete.html
  1050. share/doc/qt5/qt3d/qt3dcore-qabstractskeleton.html
  1051. share/doc/qt5/qt3d/qt3dcore-qarmature-members.html
  1052. share/doc/qt5/qt3d/qt3dcore-qarmature-obsolete.html
  1053. share/doc/qt5/qt3d/qt3dcore-qarmature.html
  1054. share/doc/qt5/qt3d/qt3dcore-qaspectengine-members.html
  1055. share/doc/qt5/qt3d/qt3dcore-qaspectengine-obsolete.html
  1056. share/doc/qt5/qt3d/qt3dcore-qaspectengine.html
  1057. share/doc/qt5/qt3d/qt3dcore-qaspectjob-members.html
  1058. share/doc/qt5/qt3d/qt3dcore-qaspectjob.html
  1059. share/doc/qt5/qt3d/qt3dcore-qbackendnode-members.html
  1060. share/doc/qt5/qt3d/qt3dcore-qbackendnode.html
  1061. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper-members.html
  1062. share/doc/qt5/qt3d/qt3dcore-qbackendnodemapper.html
  1063. share/doc/qt5/qt3d/qt3dcore-qcomponent-members.html
  1064. share/doc/qt5/qt3d/qt3dcore-qcomponent-obsolete.html
  1065. share/doc/qt5/qt3d/qt3dcore-qcomponent.html
  1066. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange-members.html
  1067. share/doc/qt5/qt3d/qt3dcore-qcomponentaddedchange.html
  1068. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange-members.html
  1069. share/doc/qt5/qt3d/qt3dcore-qcomponentremovedchange.html
  1070. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
  1071. share/doc/qt5/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
  1072. share/doc/qt5/qt3d/qt3dcore-qentity-members.html
  1073. share/doc/qt5/qt3d/qt3dcore-qentity-obsolete.html
  1074. share/doc/qt5/qt3d/qt3dcore-qentity.html
  1075. share/doc/qt5/qt3d/qt3dcore-qjoint-members.html
  1076. share/doc/qt5/qt3d/qt3dcore-qjoint-obsolete.html
  1077. share/doc/qt5/qt3d/qt3dcore-qjoint.html
  1078. share/doc/qt5/qt3d/qt3dcore-qnode-members.html
  1079. share/doc/qt5/qt3d/qt3dcore-qnode-obsolete.html
  1080. share/doc/qt5/qt3d/qt3dcore-qnode.html
  1081. share/doc/qt5/qt3d/qt3dcore-qnodecommand-members.html
  1082. share/doc/qt5/qt3d/qt3dcore-qnodecommand.html
  1083. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange-members.html
  1084. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchange.html
  1085. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase-members.html
  1086. share/doc/qt5/qt3d/qt3dcore-qnodecreatedchangebase.html
  1087. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange-members.html
  1088. share/doc/qt5/qt3d/qt3dcore-qnodedestroyedchange.html
  1089. share/doc/qt5/qt3d/qt3dcore-qnodeid-members.html
  1090. share/doc/qt5/qt3d/qt3dcore-qnodeid.html
  1091. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair-members.html
  1092. share/doc/qt5/qt3d/qt3dcore-qnodeidtypepair.html
  1093. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
  1094. share/doc/qt5/qt3d/qt3dcore-qpropertynodeaddedchange.html
  1095. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
  1096. share/doc/qt5/qt3d/qt3dcore-qpropertynoderemovedchange.html
  1097. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange-members.html
  1098. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchange.html
  1099. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
  1100. share/doc/qt5/qt3d/qt3dcore-qpropertyupdatedchangebase.html
  1101. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
  1102. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchange.html
  1103. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
  1104. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
  1105. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
  1106. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchange.html
  1107. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
  1108. share/doc/qt5/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
  1109. share/doc/qt5/qt3d/qt3dcore-qscenechange-members.html
  1110. share/doc/qt5/qt3d/qt3dcore-qscenechange.html
  1111. share/doc/qt5/qt3d/qt3dcore-qskeleton-members.html
  1112. share/doc/qt5/qt3d/qt3dcore-qskeleton-obsolete.html
  1113. share/doc/qt5/qt3d/qt3dcore-qskeleton.html
  1114. share/doc/qt5/qt3d/qt3dcore-qskeletonloader-members.html
  1115. share/doc/qt5/qt3d/qt3dcore-qskeletonloader-obsolete.html
  1116. share/doc/qt5/qt3d/qt3dcore-qskeletonloader.html
  1117. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
  1118. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
  1119. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
  1120. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
  1121. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
  1122. share/doc/qt5/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
  1123. share/doc/qt5/qt3d/qt3dcore-qtransform-members.html
  1124. share/doc/qt5/qt3d/qt3dcore-qtransform-obsolete.html
  1125. share/doc/qt5/qt3d/qt3dcore-qtransform.html
  1126. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
  1127. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine-obsolete.html
  1128. share/doc/qt5/qt3d/qt3dcore-quick-qqmlaspectengine.html
  1129. share/doc/qt5/qt3d/qt3dcore-quick.html
  1130. share/doc/qt5/qt3d/qt3dcore.html
  1131. share/doc/qt5/qt3d/qt3dextras-module.html
  1132. share/doc/qt5/qt3d/qt3dextras-obsolete.html
  1133. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-inputstate-members.html
  1134. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-inputstate.html
  1135. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-members.html
  1136. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller-obsolete.html
  1137. share/doc/qt5/qt3d/qt3dextras-qabstractcameracontroller.html
  1138. share/doc/qt5/qt3d/qt3dextras-qabstractspritesheet-members.html
  1139. share/doc/qt5/qt3d/qt3dextras-qabstractspritesheet.html
  1140. share/doc/qt5/qt3d/qt3dextras-qconegeometry-members.html
  1141. share/doc/qt5/qt3d/qt3dextras-qconegeometry-obsolete.html
  1142. share/doc/qt5/qt3d/qt3dextras-qconegeometry.html
  1143. share/doc/qt5/qt3d/qt3dextras-qconemesh-members.html
  1144. share/doc/qt5/qt3d/qt3dextras-qconemesh-obsolete.html
  1145. share/doc/qt5/qt3d/qt3dextras-qconemesh.html
  1146. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry-members.html
  1147. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry-obsolete.html
  1148. share/doc/qt5/qt3d/qt3dextras-qcuboidgeometry.html
  1149. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh-members.html
  1150. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh-obsolete.html
  1151. share/doc/qt5/qt3d/qt3dextras-qcuboidmesh.html
  1152. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry-members.html
  1153. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry-obsolete.html
  1154. share/doc/qt5/qt3d/qt3dextras-qcylindergeometry.html
  1155. share/doc/qt5/qt3d/qt3dextras-qcylindermesh-members.html
  1156. share/doc/qt5/qt3d/qt3dextras-qcylindermesh-obsolete.html
  1157. share/doc/qt5/qt3d/qt3dextras-qcylindermesh.html
  1158. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial-members.html
  1159. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial-obsolete.html
  1160. share/doc/qt5/qt3d/qt3dextras-qdiffusemapmaterial.html
  1161. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
  1162. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial-obsolete.html
  1163. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
  1164. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmaterial-members.html
  1165. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmaterial-obsolete.html
  1166. share/doc/qt5/qt3d/qt3dextras-qdiffusespecularmaterial.html
  1167. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry-members.html
  1168. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry-obsolete.html
  1169. share/doc/qt5/qt3d/qt3dextras-qextrudedtextgeometry.html
  1170. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh-members.html
  1171. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh-obsolete.html
  1172. share/doc/qt5/qt3d/qt3dextras-qextrudedtextmesh.html
  1173. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
  1174. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller-obsolete.html
  1175. share/doc/qt5/qt3d/qt3dextras-qfirstpersoncameracontroller.html
  1176. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-members.html
  1177. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer-obsolete.html
  1178. share/doc/qt5/qt3d/qt3dextras-qforwardrenderer.html
  1179. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial-members.html
  1180. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial-obsolete.html
  1181. share/doc/qt5/qt3d/qt3dextras-qgoochmaterial.html
  1182. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial-members.html
  1183. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial-obsolete.html
  1184. share/doc/qt5/qt3d/qt3dextras-qmetalroughmaterial.html
  1185. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial-members.html
  1186. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial-obsolete.html
  1187. share/doc/qt5/qt3d/qt3dextras-qmorphphongmaterial.html
  1188. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
  1189. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-obsolete.html
  1190. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
  1191. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
  1192. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial-obsolete.html
  1193. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
  1194. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
  1195. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-obsolete.html
  1196. share/doc/qt5/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
  1197. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller-members.html
  1198. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller-obsolete.html
  1199. share/doc/qt5/qt3d/qt3dextras-qorbitcameracontroller.html
  1200. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial-members.html
  1201. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial-obsolete.html
  1202. share/doc/qt5/qt3d/qt3dextras-qpervertexcolormaterial.html
  1203. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial-members.html
  1204. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial-obsolete.html
  1205. share/doc/qt5/qt3d/qt3dextras-qphongalphamaterial.html
  1206. share/doc/qt5/qt3d/qt3dextras-qphongmaterial-members.html
  1207. share/doc/qt5/qt3d/qt3dextras-qphongmaterial-obsolete.html
  1208. share/doc/qt5/qt3d/qt3dextras-qphongmaterial.html
  1209. share/doc/qt5/qt3d/qt3dextras-qplanegeometry-members.html
  1210. share/doc/qt5/qt3d/qt3dextras-qplanegeometry-obsolete.html
  1211. share/doc/qt5/qt3d/qt3dextras-qplanegeometry.html
  1212. share/doc/qt5/qt3d/qt3dextras-qplanemesh-members.html
  1213. share/doc/qt5/qt3d/qt3dextras-qplanemesh-obsolete.html
  1214. share/doc/qt5/qt3d/qt3dextras-qplanemesh.html
  1215. share/doc/qt5/qt3d/qt3dextras-qskyboxentity-members.html
  1216. share/doc/qt5/qt3d/qt3dextras-qskyboxentity-obsolete.html
  1217. share/doc/qt5/qt3d/qt3dextras-qskyboxentity.html
  1218. share/doc/qt5/qt3d/qt3dextras-qspheregeometry-members.html
  1219. share/doc/qt5/qt3d/qt3dextras-qspheregeometry-obsolete.html
  1220. share/doc/qt5/qt3d/qt3dextras-qspheregeometry.html
  1221. share/doc/qt5/qt3d/qt3dextras-qspheremesh-members.html
  1222. share/doc/qt5/qt3d/qt3dextras-qspheremesh-obsolete.html
  1223. share/doc/qt5/qt3d/qt3dextras-qspheremesh.html
  1224. share/doc/qt5/qt3d/qt3dextras-qspritegrid-members.html
  1225. share/doc/qt5/qt3d/qt3dextras-qspritegrid.html
  1226. share/doc/qt5/qt3d/qt3dextras-qspritesheet-members.html
  1227. share/doc/qt5/qt3d/qt3dextras-qspritesheet.html
  1228. share/doc/qt5/qt3d/qt3dextras-qspritesheetitem-members.html
  1229. share/doc/qt5/qt3d/qt3dextras-qspritesheetitem.html
  1230. share/doc/qt5/qt3d/qt3dextras-qt3dwindow-members.html
  1231. share/doc/qt5/qt3d/qt3dextras-qt3dwindow.html
  1232. share/doc/qt5/qt3d/qt3dextras-qtext2dentity-members.html
  1233. share/doc/qt5/qt3d/qt3dextras-qtext2dentity-obsolete.html
  1234. share/doc/qt5/qt3d/qt3dextras-qtext2dentity.html
  1235. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial-members.html
  1236. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial-obsolete.html
  1237. share/doc/qt5/qt3d/qt3dextras-qtexturedmetalroughmaterial.html
  1238. share/doc/qt5/qt3d/qt3dextras-qtexturematerial-members.html
  1239. share/doc/qt5/qt3d/qt3dextras-qtexturematerial-obsolete.html
  1240. share/doc/qt5/qt3d/qt3dextras-qtexturematerial.html
  1241. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry-members.html
  1242. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry-obsolete.html
  1243. share/doc/qt5/qt3d/qt3dextras-qtorusgeometry.html
  1244. share/doc/qt5/qt3d/qt3dextras-qtorusmesh-members.html
  1245. share/doc/qt5/qt3d/qt3dextras-qtorusmesh-obsolete.html
  1246. share/doc/qt5/qt3d/qt3dextras-qtorusmesh.html
  1247. share/doc/qt5/qt3d/qt3dextras.html
  1248. share/doc/qt5/qt3d/qt3dinput-module.html
  1249. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput-members.html
  1250. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput-obsolete.html
  1251. share/doc/qt5/qt3d/qt3dinput-qabstractactioninput.html
  1252. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput-members.html
  1253. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput-obsolete.html
  1254. share/doc/qt5/qt3d/qt3dinput-qabstractaxisinput.html
  1255. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice-members.html
  1256. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice-obsolete.html
  1257. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldevice.html
  1258. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldeviceproxy-members.html
  1259. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldeviceproxy-obsolete.html
  1260. share/doc/qt5/qt3d/qt3dinput-qabstractphysicaldeviceproxy.html
  1261. share/doc/qt5/qt3d/qt3dinput-qaction-members.html
  1262. share/doc/qt5/qt3d/qt3dinput-qaction-obsolete.html
  1263. share/doc/qt5/qt3d/qt3dinput-qaction.html
  1264. share/doc/qt5/qt3d/qt3dinput-qactioninput-members.html
  1265. share/doc/qt5/qt3d/qt3dinput-qactioninput-obsolete.html
  1266. share/doc/qt5/qt3d/qt3dinput-qactioninput.html
  1267. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput-members.html
  1268. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput-obsolete.html
  1269. share/doc/qt5/qt3d/qt3dinput-qanalogaxisinput.html
  1270. share/doc/qt5/qt3d/qt3dinput-qaxis-members.html
  1271. share/doc/qt5/qt3d/qt3dinput-qaxis-obsolete.html
  1272. share/doc/qt5/qt3d/qt3dinput-qaxis.html
  1273. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator-members.html
  1274. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator-obsolete.html
  1275. share/doc/qt5/qt3d/qt3dinput-qaxisaccumulator.html
  1276. share/doc/qt5/qt3d/qt3dinput-qaxissetting-members.html
  1277. share/doc/qt5/qt3d/qt3dinput-qaxissetting-obsolete.html
  1278. share/doc/qt5/qt3d/qt3dinput-qaxissetting.html
  1279. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput-members.html
  1280. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput-obsolete.html
  1281. share/doc/qt5/qt3d/qt3dinput-qbuttonaxisinput.html
  1282. share/doc/qt5/qt3d/qt3dinput-qinputaspect-members.html
  1283. share/doc/qt5/qt3d/qt3dinput-qinputaspect-obsolete.html
  1284. share/doc/qt5/qt3d/qt3dinput-qinputaspect.html
  1285. share/doc/qt5/qt3d/qt3dinput-qinputchord-members.html
  1286. share/doc/qt5/qt3d/qt3dinput-qinputchord-obsolete.html
  1287. share/doc/qt5/qt3d/qt3dinput-qinputchord.html
  1288. share/doc/qt5/qt3d/qt3dinput-qinputdeviceintegration-members.html
  1289. share/doc/qt5/qt3d/qt3dinput-qinputdeviceintegration-obsolete.html
  1290. share/doc/qt5/qt3d/qt3dinput-qinputdeviceintegration.html
  1291. share/doc/qt5/qt3d/qt3dinput-qinputsequence-members.html
  1292. share/doc/qt5/qt3d/qt3dinput-qinputsequence-obsolete.html
  1293. share/doc/qt5/qt3d/qt3dinput-qinputsequence.html
  1294. share/doc/qt5/qt3d/qt3dinput-qinputsettings-members.html
  1295. share/doc/qt5/qt3d/qt3dinput-qinputsettings-obsolete.html
  1296. share/doc/qt5/qt3d/qt3dinput-qinputsettings.html
  1297. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice-members.html
  1298. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice-obsolete.html
  1299. share/doc/qt5/qt3d/qt3dinput-qkeyboarddevice.html
  1300. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler-members.html
  1301. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler-obsolete.html
  1302. share/doc/qt5/qt3d/qt3dinput-qkeyboardhandler.html
  1303. share/doc/qt5/qt3d/qt3dinput-qkeyevent-members.html
  1304. share/doc/qt5/qt3d/qt3dinput-qkeyevent-obsolete.html
  1305. share/doc/qt5/qt3d/qt3dinput-qkeyevent.html
  1306. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice-members.html
  1307. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice-obsolete.html
  1308. share/doc/qt5/qt3d/qt3dinput-qlogicaldevice.html
  1309. share/doc/qt5/qt3d/qt3dinput-qmousedevice-members.html
  1310. share/doc/qt5/qt3d/qt3dinput-qmousedevice-obsolete.html
  1311. share/doc/qt5/qt3d/qt3dinput-qmousedevice.html
  1312. share/doc/qt5/qt3d/qt3dinput-qmouseevent-members.html
  1313. share/doc/qt5/qt3d/qt3dinput-qmouseevent-obsolete.html
  1314. share/doc/qt5/qt3d/qt3dinput-qmouseevent.html
  1315. share/doc/qt5/qt3d/qt3dinput-qmousehandler-members.html
  1316. share/doc/qt5/qt3d/qt3dinput-qmousehandler-obsolete.html
  1317. share/doc/qt5/qt3d/qt3dinput-qmousehandler.html
  1318. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange-members.html
  1319. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchange.html
  1320. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase-members.html
  1321. share/doc/qt5/qt3d/qt3dinput-qphysicaldevicecreatedchangebase.html
  1322. share/doc/qt5/qt3d/qt3dinput-qwheelevent-members.html
  1323. share/doc/qt5/qt3d/qt3dinput-qwheelevent-obsolete.html
  1324. share/doc/qt5/qt3d/qt3dinput-qwheelevent.html
  1325. share/doc/qt5/qt3d/qt3dinput.html
  1326. share/doc/qt5/qt3d/qt3dlogic-logic.html
  1327. share/doc/qt5/qt3d/qt3dlogic-module.html
  1328. share/doc/qt5/qt3d/qt3dlogic-qframeaction-members.html
  1329. share/doc/qt5/qt3d/qt3dlogic-qframeaction-obsolete.html
  1330. share/doc/qt5/qt3d/qt3dlogic-qframeaction.html
  1331. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect-members.html
  1332. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect-obsolete.html
  1333. share/doc/qt5/qt3d/qt3dlogic-qlogicaspect.html
  1334. share/doc/qt5/qt3d/qt3dlogic.html
  1335. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader-members.html
  1336. share/doc/qt5/qt3d/qt3drender-fbxgeometryloader.html
  1337. share/doc/qt5/qt3d/qt3drender-framegraph.html
  1338. share/doc/qt5/qt3d/qt3drender-functortype-members.html
  1339. share/doc/qt5/qt3d/qt3drender-functortype.html
  1340. share/doc/qt5/qt3d/qt3drender-geometry.html
  1341. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader-members.html
  1342. share/doc/qt5/qt3d/qt3drender-gltfgeometryloader.html
  1343. share/doc/qt5/qt3d/qt3drender-module.html
  1344. share/doc/qt5/qt3d/qt3drender-objgeometryloader-members.html
  1345. share/doc/qt5/qt3d/qt3drender-objgeometryloader.html
  1346. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element-members.html
  1347. share/doc/qt5/qt3d/qt3drender-plygeometryloader-element.html
  1348. share/doc/qt5/qt3d/qt3drender-plygeometryloader-members.html
  1349. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property-members.html
  1350. share/doc/qt5/qt3d/qt3drender-plygeometryloader-property.html
  1351. share/doc/qt5/qt3d/qt3drender-plygeometryloader.html
  1352. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface-members.html
  1353. share/doc/qt5/qt3d/qt3drender-propertyreaderinterface.html
  1354. share/doc/qt5/qt3d/qt3drender-protips.html
  1355. share/doc/qt5/qt3d/qt3drender-qabstractfunctor-members.html
  1356. share/doc/qt5/qt3d/qt3drender-qabstractfunctor.html
  1357. share/doc/qt5/qt3d/qt3drender-qabstractlight-members.html
  1358. share/doc/qt5/qt3d/qt3drender-qabstractlight-obsolete.html
  1359. share/doc/qt5/qt3d/qt3drender-qabstractlight.html
  1360. share/doc/qt5/qt3d/qt3drender-qabstractraycaster-members.html
  1361. share/doc/qt5/qt3d/qt3drender-qabstractraycaster-obsolete.html
  1362. share/doc/qt5/qt3d/qt3drender-qabstractraycaster.html
  1363. share/doc/qt5/qt3d/qt3drender-qabstracttexture-members.html
  1364. share/doc/qt5/qt3d/qt3drender-qabstracttexture-obsolete.html
  1365. share/doc/qt5/qt3d/qt3drender-qabstracttexture.html
  1366. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage-members.html
  1367. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage-obsolete.html
  1368. share/doc/qt5/qt3d/qt3drender-qabstracttextureimage.html
  1369. share/doc/qt5/qt3d/qt3drender-qalphacoverage-members.html
  1370. share/doc/qt5/qt3d/qt3drender-qalphacoverage-obsolete.html
  1371. share/doc/qt5/qt3d/qt3drender-qalphacoverage.html
  1372. share/doc/qt5/qt3d/qt3drender-qalphatest-members.html
  1373. share/doc/qt5/qt3d/qt3drender-qalphatest-obsolete.html
  1374. share/doc/qt5/qt3d/qt3drender-qalphatest.html
  1375. share/doc/qt5/qt3d/qt3drender-qattribute-members.html
  1376. share/doc/qt5/qt3d/qt3drender-qattribute-obsolete.html
  1377. share/doc/qt5/qt3d/qt3drender-qattribute.html
  1378. share/doc/qt5/qt3d/qt3drender-qblendequation-members.html
  1379. share/doc/qt5/qt3d/qt3drender-qblendequation-obsolete.html
  1380. share/doc/qt5/qt3d/qt3drender-qblendequation.html
  1381. share/doc/qt5/qt3d/qt3drender-qblendequationarguments-members.html
  1382. share/doc/qt5/qt3d/qt3drender-qblendequationarguments-obsolete.html
  1383. share/doc/qt5/qt3d/qt3drender-qblendequationarguments.html
  1384. share/doc/qt5/qt3d/qt3drender-qblitframebuffer-members.html
  1385. share/doc/qt5/qt3d/qt3drender-qblitframebuffer-obsolete.html
  1386. share/doc/qt5/qt3d/qt3drender-qblitframebuffer.html
  1387. share/doc/qt5/qt3d/qt3drender-qbuffer-members.html
  1388. share/doc/qt5/qt3d/qt3drender-qbuffer-obsolete.html
  1389. share/doc/qt5/qt3d/qt3drender-qbuffer.html
  1390. share/doc/qt5/qt3d/qt3drender-qbuffercapture-members.html
  1391. share/doc/qt5/qt3d/qt3drender-qbuffercapture-obsolete.html
  1392. share/doc/qt5/qt3d/qt3drender-qbuffercapture.html
  1393. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator-members.html
  1394. share/doc/qt5/qt3d/qt3drender-qbufferdatagenerator.html
  1395. share/doc/qt5/qt3d/qt3drender-qcamera-members.html
  1396. share/doc/qt5/qt3d/qt3drender-qcamera-obsolete.html
  1397. share/doc/qt5/qt3d/qt3drender-qcamera.html
  1398. share/doc/qt5/qt3d/qt3drender-qcameralens-members.html
  1399. share/doc/qt5/qt3d/qt3drender-qcameralens-obsolete.html
  1400. share/doc/qt5/qt3d/qt3drender-qcameralens.html
  1401. share/doc/qt5/qt3d/qt3drender-qcameraselector-members.html
  1402. share/doc/qt5/qt3d/qt3drender-qcameraselector-obsolete.html
  1403. share/doc/qt5/qt3d/qt3drender-qcameraselector.html
  1404. share/doc/qt5/qt3d/qt3drender-qclearbuffers-members.html
  1405. share/doc/qt5/qt3d/qt3drender-qclearbuffers-obsolete.html
  1406. share/doc/qt5/qt3d/qt3drender-qclearbuffers.html
  1407. share/doc/qt5/qt3d/qt3drender-qclipplane-members.html
  1408. share/doc/qt5/qt3d/qt3drender-qclipplane-obsolete.html
  1409. share/doc/qt5/qt3d/qt3drender-qclipplane.html
  1410. share/doc/qt5/qt3d/qt3drender-qcolormask-members.html
  1411. share/doc/qt5/qt3d/qt3drender-qcolormask-obsolete.html
  1412. share/doc/qt5/qt3d/qt3drender-qcolormask.html
  1413. share/doc/qt5/qt3d/qt3drender-qcomputecommand-members.html
  1414. share/doc/qt5/qt3d/qt3drender-qcomputecommand-obsolete.html
  1415. share/doc/qt5/qt3d/qt3drender-qcomputecommand.html
  1416. share/doc/qt5/qt3d/qt3drender-qcullface-members.html
  1417. share/doc/qt5/qt3d/qt3drender-qcullface-obsolete.html
  1418. share/doc/qt5/qt3d/qt3drender-qcullface.html
  1419. share/doc/qt5/qt3d/qt3drender-qdepthtest-members.html
  1420. share/doc/qt5/qt3d/qt3drender-qdepthtest-obsolete.html
  1421. share/doc/qt5/qt3d/qt3drender-qdepthtest.html
  1422. share/doc/qt5/qt3d/qt3drender-qdirectionallight-members.html
  1423. share/doc/qt5/qt3d/qt3drender-qdirectionallight-obsolete.html
  1424. share/doc/qt5/qt3d/qt3drender-qdirectionallight.html
  1425. share/doc/qt5/qt3d/qt3drender-qdispatchcompute-members.html
  1426. share/doc/qt5/qt3d/qt3drender-qdispatchcompute-obsolete.html
  1427. share/doc/qt5/qt3d/qt3drender-qdispatchcompute.html
  1428. share/doc/qt5/qt3d/qt3drender-qdithering-members.html
  1429. share/doc/qt5/qt3d/qt3drender-qdithering-obsolete.html
  1430. share/doc/qt5/qt3d/qt3drender-qdithering.html
  1431. share/doc/qt5/qt3d/qt3drender-qeffect-members.html
  1432. share/doc/qt5/qt3d/qt3drender-qeffect-obsolete.html
  1433. share/doc/qt5/qt3d/qt3drender-qeffect.html
  1434. share/doc/qt5/qt3d/qt3drender-qenvironmentlight-members.html
  1435. share/doc/qt5/qt3d/qt3drender-qenvironmentlight-obsolete.html
  1436. share/doc/qt5/qt3d/qt3drender-qenvironmentlight.html
  1437. share/doc/qt5/qt3d/qt3drender-qfilterkey-members.html
  1438. share/doc/qt5/qt3d/qt3drender-qfilterkey-obsolete.html
  1439. share/doc/qt5/qt3d/qt3drender-qfilterkey.html
  1440. share/doc/qt5/qt3d/qt3drender-qframegraphnode-members.html
  1441. share/doc/qt5/qt3d/qt3drender-qframegraphnode-obsolete.html
  1442. share/doc/qt5/qt3d/qt3drender-qframegraphnode.html
  1443. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange-members.html
  1444. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchange.html
  1445. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase-members.html
  1446. share/doc/qt5/qt3d/qt3drender-qframegraphnodecreatedchangebase.html
  1447. share/doc/qt5/qt3d/qt3drender-qfrontface-members.html
  1448. share/doc/qt5/qt3d/qt3drender-qfrontface-obsolete.html
  1449. share/doc/qt5/qt3d/qt3drender-qfrontface.html
  1450. share/doc/qt5/qt3d/qt3drender-qfrustumculling-members.html
  1451. share/doc/qt5/qt3d/qt3drender-qfrustumculling-obsolete.html
  1452. share/doc/qt5/qt3d/qt3drender-qfrustumculling.html
  1453. share/doc/qt5/qt3d/qt3drender-qgeometry-members.html
  1454. share/doc/qt5/qt3d/qt3drender-qgeometry-obsolete.html
  1455. share/doc/qt5/qt3d/qt3drender-qgeometry.html
  1456. share/doc/qt5/qt3d/qt3drender-qgeometryfactory-members.html
  1457. share/doc/qt5/qt3d/qt3drender-qgeometryfactory.html
  1458. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer-members.html
  1459. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer-obsolete.html
  1460. share/doc/qt5/qt3d/qt3drender-qgeometryrenderer.html
  1461. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter-members.html
  1462. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter-obsolete.html
  1463. share/doc/qt5/qt3d/qt3drender-qgraphicsapifilter.html
  1464. share/doc/qt5/qt3d/qt3drender-qlayer-members.html
  1465. share/doc/qt5/qt3d/qt3drender-qlayer-obsolete.html
  1466. share/doc/qt5/qt3d/qt3drender-qlayer.html
  1467. share/doc/qt5/qt3d/qt3drender-qlayerfilter-members.html
  1468. share/doc/qt5/qt3d/qt3drender-qlayerfilter-obsolete.html
  1469. share/doc/qt5/qt3d/qt3drender-qlayerfilter.html
  1470. share/doc/qt5/qt3d/qt3drender-qlevelofdetail-members.html
  1471. share/doc/qt5/qt3d/qt3drender-qlevelofdetail-obsolete.html
  1472. share/doc/qt5/qt3d/qt3drender-qlevelofdetail.html
  1473. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
  1474. share/doc/qt5/qt3d/qt3drender-qlevelofdetailboundingsphere.html
  1475. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch-members.html
  1476. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch-obsolete.html
  1477. share/doc/qt5/qt3d/qt3drender-qlevelofdetailswitch.html
  1478. share/doc/qt5/qt3d/qt3drender-qlinewidth-members.html
  1479. share/doc/qt5/qt3d/qt3drender-qlinewidth-obsolete.html
  1480. share/doc/qt5/qt3d/qt3drender-qlinewidth.html
  1481. share/doc/qt5/qt3d/qt3drender-qmaterial-members.html
  1482. share/doc/qt5/qt3d/qt3drender-qmaterial-obsolete.html
  1483. share/doc/qt5/qt3d/qt3drender-qmaterial.html
  1484. share/doc/qt5/qt3d/qt3drender-qmemorybarrier-members.html
  1485. share/doc/qt5/qt3d/qt3drender-qmemorybarrier-obsolete.html
  1486. share/doc/qt5/qt3d/qt3drender-qmemorybarrier.html
  1487. share/doc/qt5/qt3d/qt3drender-qmesh-members.html
  1488. share/doc/qt5/qt3d/qt3drender-qmesh-obsolete.html
  1489. share/doc/qt5/qt3d/qt3drender-qmesh.html
  1490. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing-members.html
  1491. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing-obsolete.html
  1492. share/doc/qt5/qt3d/qt3drender-qmultisampleantialiasing.html
  1493. share/doc/qt5/qt3d/qt3drender-qnodepthmask-members.html
  1494. share/doc/qt5/qt3d/qt3drender-qnodepthmask-obsolete.html
  1495. share/doc/qt5/qt3d/qt3drender-qnodepthmask.html
  1496. share/doc/qt5/qt3d/qt3drender-qnodraw-members.html
  1497. share/doc/qt5/qt3d/qt3drender-qnodraw-obsolete.html
  1498. share/doc/qt5/qt3d/qt3drender-qnodraw.html
  1499. share/doc/qt5/qt3d/qt3drender-qobjectpicker-members.html
  1500. share/doc/qt5/qt3d/qt3drender-qobjectpicker-obsolete.html
  1501. share/doc/qt5/qt3d/qt3drender-qobjectpicker.html
  1502. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage-members.html
  1503. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage-obsolete.html
  1504. share/doc/qt5/qt3d/qt3drender-qpaintedtextureimage.html
  1505. share/doc/qt5/qt3d/qt3drender-qparameter-members.html
  1506. share/doc/qt5/qt3d/qt3drender-qparameter-obsolete.html
  1507. share/doc/qt5/qt3d/qt3drender-qparameter.html
  1508. share/doc/qt5/qt3d/qt3drender-qpickevent-members.html
  1509. share/doc/qt5/qt3d/qt3drender-qpickevent-obsolete.html
  1510. share/doc/qt5/qt3d/qt3drender-qpickevent.html
  1511. share/doc/qt5/qt3d/qt3drender-qpickingsettings-members.html
  1512. share/doc/qt5/qt3d/qt3drender-qpickingsettings-obsolete.html
  1513. share/doc/qt5/qt3d/qt3drender-qpickingsettings.html
  1514. share/doc/qt5/qt3d/qt3drender-qpicklineevent-members.html
  1515. share/doc/qt5/qt3d/qt3drender-qpicklineevent-obsolete.html
  1516. share/doc/qt5/qt3d/qt3drender-qpicklineevent.html
  1517. share/doc/qt5/qt3d/qt3drender-qpickpointevent-members.html
  1518. share/doc/qt5/qt3d/qt3drender-qpickpointevent-obsolete.html
  1519. share/doc/qt5/qt3d/qt3drender-qpickpointevent.html
  1520. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent-members.html
  1521. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent-obsolete.html
  1522. share/doc/qt5/qt3d/qt3drender-qpicktriangleevent.html
  1523. share/doc/qt5/qt3d/qt3drender-qpointlight-members.html
  1524. share/doc/qt5/qt3d/qt3drender-qpointlight-obsolete.html
  1525. share/doc/qt5/qt3d/qt3drender-qpointlight.html
  1526. share/doc/qt5/qt3d/qt3drender-qpointsize-members.html
  1527. share/doc/qt5/qt3d/qt3drender-qpointsize-obsolete.html
  1528. share/doc/qt5/qt3d/qt3drender-qpointsize.html
  1529. share/doc/qt5/qt3d/qt3drender-qpolygonoffset-members.html
  1530. share/doc/qt5/qt3d/qt3drender-qpolygonoffset-obsolete.html
  1531. share/doc/qt5/qt3d/qt3drender-qpolygonoffset.html
  1532. share/doc/qt5/qt3d/qt3drender-qproximityfilter-members.html
  1533. share/doc/qt5/qt3d/qt3drender-qproximityfilter-obsolete.html
  1534. share/doc/qt5/qt3d/qt3drender-qproximityfilter.html
  1535. share/doc/qt5/qt3d/qt3drender-qraycaster-members.html
  1536. share/doc/qt5/qt3d/qt3drender-qraycaster-obsolete.html
  1537. share/doc/qt5/qt3d/qt3drender-qraycaster.html
  1538. share/doc/qt5/qt3d/qt3drender-qraycasterhit-members.html
  1539. share/doc/qt5/qt3d/qt3drender-qraycasterhit.html
  1540. share/doc/qt5/qt3d/qt3drender-qrenderaspect-members.html
  1541. share/doc/qt5/qt3d/qt3drender-qrenderaspect-obsolete.html
  1542. share/doc/qt5/qt3d/qt3drender-qrenderaspect.html
  1543. share/doc/qt5/qt3d/qt3drender-qrendercapture-members.html
  1544. share/doc/qt5/qt3d/qt3drender-qrendercapture-obsolete.html
  1545. share/doc/qt5/qt3d/qt3drender-qrendercapture.html
  1546. share/doc/qt5/qt3d/qt3drender-qrendercapturereply-members.html
  1547. share/doc/qt5/qt3d/qt3drender-qrendercapturereply-obsolete.html
  1548. share/doc/qt5/qt3d/qt3drender-qrendercapturereply.html
  1549. share/doc/qt5/qt3d/qt3drender-qrenderpass-members.html
  1550. share/doc/qt5/qt3d/qt3drender-qrenderpass-obsolete.html
  1551. share/doc/qt5/qt3d/qt3drender-qrenderpass.html
  1552. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter-members.html
  1553. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter-obsolete.html
  1554. share/doc/qt5/qt3d/qt3drender-qrenderpassfilter.html
  1555. share/doc/qt5/qt3d/qt3drender-qrendersettings-members.html
  1556. share/doc/qt5/qt3d/qt3drender-qrendersettings-obsolete.html
  1557. share/doc/qt5/qt3d/qt3drender-qrendersettings.html
  1558. share/doc/qt5/qt3d/qt3drender-qrenderstate-members.html
  1559. share/doc/qt5/qt3d/qt3drender-qrenderstate-obsolete.html
  1560. share/doc/qt5/qt3d/qt3drender-qrenderstate.html
  1561. share/doc/qt5/qt3d/qt3drender-qrenderstateset-members.html
  1562. share/doc/qt5/qt3d/qt3drender-qrenderstateset-obsolete.html
  1563. share/doc/qt5/qt3d/qt3drender-qrenderstateset.html
  1564. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector-members.html
  1565. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector-obsolete.html
  1566. share/doc/qt5/qt3d/qt3drender-qrendersurfaceselector.html
  1567. share/doc/qt5/qt3d/qt3drender-qrendertarget-members.html
  1568. share/doc/qt5/qt3d/qt3drender-qrendertarget-obsolete.html
  1569. share/doc/qt5/qt3d/qt3drender-qrendertarget.html
  1570. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput-members.html
  1571. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput-obsolete.html
  1572. share/doc/qt5/qt3d/qt3drender-qrendertargetoutput.html
  1573. share/doc/qt5/qt3d/qt3drender-qrendertargetselector-members.html
  1574. share/doc/qt5/qt3d/qt3drender-qrendertargetselector-obsolete.html
  1575. share/doc/qt5/qt3d/qt3drender-qrendertargetselector.html
  1576. share/doc/qt5/qt3d/qt3drender-qsceneloader-members.html
  1577. share/doc/qt5/qt3d/qt3drender-qsceneloader-obsolete.html
  1578. share/doc/qt5/qt3d/qt3drender-qsceneloader.html
  1579. share/doc/qt5/qt3d/qt3drender-qscissortest-members.html
  1580. share/doc/qt5/qt3d/qt3drender-qscissortest-obsolete.html
  1581. share/doc/qt5/qt3d/qt3drender-qscissortest.html
  1582. share/doc/qt5/qt3d/qt3drender-qscreenraycaster-members.html
  1583. share/doc/qt5/qt3d/qt3drender-qscreenraycaster-obsolete.html
  1584. share/doc/qt5/qt3d/qt3drender-qscreenraycaster.html
  1585. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap-members.html
  1586. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap-obsolete.html
  1587. share/doc/qt5/qt3d/qt3drender-qseamlesscubemap.html
  1588. share/doc/qt5/qt3d/qt3drender-qshaderdata-members.html
  1589. share/doc/qt5/qt3d/qt3drender-qshaderdata-obsolete.html
  1590. share/doc/qt5/qt3d/qt3drender-qshaderdata.html
  1591. share/doc/qt5/qt3d/qt3drender-qshaderprogram-members.html
  1592. share/doc/qt5/qt3d/qt3drender-qshaderprogram-obsolete.html
  1593. share/doc/qt5/qt3d/qt3drender-qshaderprogram.html
  1594. share/doc/qt5/qt3d/qt3drender-qshaderprogrambuilder-members.html
  1595. share/doc/qt5/qt3d/qt3drender-qshaderprogrambuilder-obsolete.html
  1596. share/doc/qt5/qt3d/qt3drender-qshaderprogrambuilder.html
  1597. share/doc/qt5/qt3d/qt3drender-qsortpolicy-members.html
  1598. share/doc/qt5/qt3d/qt3drender-qsortpolicy-obsolete.html
  1599. share/doc/qt5/qt3d/qt3drender-qsortpolicy.html
  1600. share/doc/qt5/qt3d/qt3drender-qspotlight-members.html
  1601. share/doc/qt5/qt3d/qt3drender-qspotlight-obsolete.html
  1602. share/doc/qt5/qt3d/qt3drender-qspotlight.html
  1603. share/doc/qt5/qt3d/qt3drender-qstencilmask-members.html
  1604. share/doc/qt5/qt3d/qt3drender-qstencilmask-obsolete.html
  1605. share/doc/qt5/qt3d/qt3drender-qstencilmask.html
  1606. share/doc/qt5/qt3d/qt3drender-qstenciloperation-members.html
  1607. share/doc/qt5/qt3d/qt3drender-qstenciloperation-obsolete.html
  1608. share/doc/qt5/qt3d/qt3drender-qstenciloperation.html
  1609. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments-members.html
  1610. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments-obsolete.html
  1611. share/doc/qt5/qt3d/qt3drender-qstenciloperationarguments.html
  1612. share/doc/qt5/qt3d/qt3drender-qstenciltest-members.html
  1613. share/doc/qt5/qt3d/qt3drender-qstenciltest-obsolete.html
  1614. share/doc/qt5/qt3d/qt3drender-qstenciltest.html
  1615. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments-members.html
  1616. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments-obsolete.html
  1617. share/doc/qt5/qt3d/qt3drender-qstenciltestarguments.html
  1618. share/doc/qt5/qt3d/qt3drender-qtechnique-members.html
  1619. share/doc/qt5/qt3d/qt3drender-qtechnique-obsolete.html
  1620. share/doc/qt5/qt3d/qt3drender-qtechnique.html
  1621. share/doc/qt5/qt3d/qt3drender-qtechniquefilter-members.html
  1622. share/doc/qt5/qt3d/qt3drender-qtechniquefilter-obsolete.html
  1623. share/doc/qt5/qt3d/qt3drender-qtechniquefilter.html
  1624. share/doc/qt5/qt3d/qt3drender-qtexture1d-members.html
  1625. share/doc/qt5/qt3d/qt3drender-qtexture1d-obsolete.html
  1626. share/doc/qt5/qt3d/qt3drender-qtexture1d.html
  1627. share/doc/qt5/qt3d/qt3drender-qtexture1darray-members.html
  1628. share/doc/qt5/qt3d/qt3drender-qtexture1darray-obsolete.html
  1629. share/doc/qt5/qt3d/qt3drender-qtexture1darray.html
  1630. share/doc/qt5/qt3d/qt3drender-qtexture2d-members.html
  1631. share/doc/qt5/qt3d/qt3drender-qtexture2d-obsolete.html
  1632. share/doc/qt5/qt3d/qt3drender-qtexture2d.html
  1633. share/doc/qt5/qt3d/qt3drender-qtexture2darray-members.html
  1634. share/doc/qt5/qt3d/qt3drender-qtexture2darray-obsolete.html
  1635. share/doc/qt5/qt3d/qt3drender-qtexture2darray.html
  1636. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample-members.html
  1637. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample-obsolete.html
  1638. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisample.html
  1639. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
  1640. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray-obsolete.html
  1641. share/doc/qt5/qt3d/qt3drender-qtexture2dmultisamplearray.html
  1642. share/doc/qt5/qt3d/qt3drender-qtexture3d-members.html
  1643. share/doc/qt5/qt3d/qt3drender-qtexture3d-obsolete.html
  1644. share/doc/qt5/qt3d/qt3drender-qtexture3d.html
  1645. share/doc/qt5/qt3d/qt3drender-qtexturebuffer-members.html
  1646. share/doc/qt5/qt3d/qt3drender-qtexturebuffer-obsolete.html
  1647. share/doc/qt5/qt3d/qt3drender-qtexturebuffer.html
  1648. share/doc/qt5/qt3d/qt3drender-qtexturecubemap-members.html
  1649. share/doc/qt5/qt3d/qt3drender-qtexturecubemap-obsolete.html
  1650. share/doc/qt5/qt3d/qt3drender-qtexturecubemap.html
  1651. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray-members.html
  1652. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray-obsolete.html
  1653. share/doc/qt5/qt3d/qt3drender-qtexturecubemaparray.html
  1654. share/doc/qt5/qt3d/qt3drender-qtexturedata-members.html
  1655. share/doc/qt5/qt3d/qt3drender-qtexturedata.html
  1656. share/doc/qt5/qt3d/qt3drender-qtexturegenerator-members.html
  1657. share/doc/qt5/qt3d/qt3drender-qtexturegenerator.html
  1658. share/doc/qt5/qt3d/qt3drender-qtextureimage-members.html
  1659. share/doc/qt5/qt3d/qt3drender-qtextureimage-obsolete.html
  1660. share/doc/qt5/qt3d/qt3drender-qtextureimage.html
  1661. share/doc/qt5/qt3d/qt3drender-qtextureimagedata-members.html
  1662. share/doc/qt5/qt3d/qt3drender-qtextureimagedata.html
  1663. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator-members.html
  1664. share/doc/qt5/qt3d/qt3drender-qtextureimagedatagenerator.html
  1665. share/doc/qt5/qt3d/qt3drender-qtextureloader-members.html
  1666. share/doc/qt5/qt3d/qt3drender-qtextureloader-obsolete.html
  1667. share/doc/qt5/qt3d/qt3drender-qtextureloader.html
  1668. share/doc/qt5/qt3d/qt3drender-qtexturerectangle-members.html
  1669. share/doc/qt5/qt3d/qt3drender-qtexturerectangle-obsolete.html
  1670. share/doc/qt5/qt3d/qt3drender-qtexturerectangle.html
  1671. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode-members.html
  1672. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode-obsolete.html
  1673. share/doc/qt5/qt3d/qt3drender-qtexturewrapmode.html
  1674. share/doc/qt5/qt3d/qt3drender-quick-qscene2d-members.html
  1675. share/doc/qt5/qt3d/qt3drender-quick-qscene2d-obsolete.html
  1676. share/doc/qt5/qt3d/qt3drender-quick-qscene2d.html
  1677. share/doc/qt5/qt3d/qt3drender-quick-sub-qt3d.html
  1678. share/doc/qt5/qt3d/qt3drender-qviewport-members.html
  1679. share/doc/qt5/qt3d/qt3drender-qviewport-obsolete.html
  1680. share/doc/qt5/qt3d/qt3drender-qviewport.html
  1681. share/doc/qt5/qt3d/qt3drender-render.html
  1682. share/doc/qt5/qt3d/qt3drender-stlgeometryloader-members.html
  1683. share/doc/qt5/qt3d/qt3drender-stlgeometryloader.html
  1684. share/doc/qt5/qt3d/qt3drender.html
  1685. share/doc/qt5/qt3d/qt3dscene2d-module.html
  1686. share/doc/qt5/qt3d/qtquick-scene2d-qmlmodule.html
  1687. share/doc/qt5/qt3d/qtquick-scene3d-qmlmodule.html
  1688. share/doc/qt5/qt3d/style/offline-simple.css
  1689. share/doc/qt5/qt3d/style/offline.css
  1690. share/doc/qt5/qtandroidextras.qch
  1691. share/doc/qt5/qtandroidextras/examples-manifest.xml
  1692. share/doc/qt5/qtandroidextras/examples-qtandroidextras.html
  1693. share/doc/qt5/qtandroidextras/images/arrow_bc.png
  1694. share/doc/qt5/qtandroidextras/images/bgrContent.png
  1695. share/doc/qt5/qtandroidextras/images/btn_next.png
  1696. share/doc/qt5/qtandroidextras/images/btn_prev.png
  1697. share/doc/qt5/qtandroidextras/images/bullet_dn.png
  1698. share/doc/qt5/qtandroidextras/images/bullet_sq.png
  1699. share/doc/qt5/qtandroidextras/images/home.png
  1700. share/doc/qt5/qtandroidextras/images/ico_note.png
  1701. share/doc/qt5/qtandroidextras/images/ico_note_attention.png
  1702. share/doc/qt5/qtandroidextras/images/ico_out.png
  1703. share/doc/qt5/qtandroidextras/images/logo.png
  1704. share/doc/qt5/qtandroidextras/images/notification.png
  1705. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/android-sources/res/drawable/icon.png
  1706. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/happy.png
  1707. share/doc/qt5/qtandroidextras/images/used-in-examples/notification/images/sad.png
  1708. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver-members.html
  1709. share/doc/qt5/qtandroidextras/qandroidactivityresultreceiver.html
  1710. share/doc/qt5/qtandroidextras/qandroidbinder-members.html
  1711. share/doc/qt5/qtandroidextras/qandroidbinder.html
  1712. share/doc/qt5/qtandroidextras/qandroidintent-members.html
  1713. share/doc/qt5/qtandroidextras/qandroidintent.html
  1714. share/doc/qt5/qtandroidextras/qandroidjnienvironment-members.html
  1715. share/doc/qt5/qtandroidextras/qandroidjnienvironment.html
  1716. share/doc/qt5/qtandroidextras/qandroidjniexceptioncleaner-members.html
  1717. share/doc/qt5/qtandroidextras/qandroidjniexceptioncleaner.html
  1718. share/doc/qt5/qtandroidextras/qandroidjniobject-members.html
  1719. share/doc/qt5/qtandroidextras/qandroidjniobject.html
  1720. share/doc/qt5/qtandroidextras/qandroidparcel-members.html
  1721. share/doc/qt5/qtandroidextras/qandroidparcel.html
  1722. share/doc/qt5/qtandroidextras/qandroidservice-members.html
  1723. share/doc/qt5/qtandroidextras/qandroidservice-obsolete.html
  1724. share/doc/qt5/qtandroidextras/qandroidservice.html
  1725. share/doc/qt5/qtandroidextras/qandroidserviceconnection-members.html
  1726. share/doc/qt5/qtandroidextras/qandroidserviceconnection.html
  1727. share/doc/qt5/qtandroidextras/qtandroid.html
  1728. share/doc/qt5/qtandroidextras/qtandroidextras-index.html
  1729. share/doc/qt5/qtandroidextras/qtandroidextras-module.html
  1730. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-androidmanifest-xml.html
  1731. share/doc/qt5/qtandroidextras/qtandroidextras-notification-android-sources-src-org-qtproject-example-notification-notificationclient-java.html
  1732. share/doc/qt5/qtandroidextras/qtandroidextras-notification-example.html
  1733. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-cpp.html
  1734. share/doc/qt5/qtandroidextras/qtandroidextras-notification-main-qrc.html
  1735. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notification-pro.html
  1736. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-cpp.html
  1737. share/doc/qt5/qtandroidextras/qtandroidextras-notification-notificationclient-h.html
  1738. share/doc/qt5/qtandroidextras/qtandroidextras-notification-qml-main-qml.html
  1739. share/doc/qt5/qtandroidextras/qtandroidextras.index
  1740. share/doc/qt5/qtandroidextras/qtandroidextras.qhp
  1741. share/doc/qt5/qtandroidextras/qtandroidextras.qhp.sha1
  1742. share/doc/qt5/qtandroidextras/style/offline-simple.css
  1743. share/doc/qt5/qtandroidextras/style/offline.css
  1744. share/doc/qt5/qtassistant.qch
  1745. share/doc/qt5/qtassistant/assistant-custom-help-viewer.html
  1746. share/doc/qt5/qtassistant/assistant-details.html
  1747. share/doc/qt5/qtassistant/assistant-quick-guide.html
  1748. share/doc/qt5/qtassistant/examples-manifest.xml
  1749. share/doc/qt5/qtassistant/examples-qtassistant.html
  1750. share/doc/qt5/qtassistant/images/arrow_bc.png
  1751. share/doc/qt5/qtassistant/images/assistant-assistant.png
  1752. share/doc/qt5/qtassistant/images/assistant-bookmarks.png
  1753. share/doc/qt5/qtassistant/images/assistant-dockwidgets.png
  1754. share/doc/qt5/qtassistant/images/assistant-examples.png
  1755. share/doc/qt5/qtassistant/images/assistant-index.png
  1756. share/doc/qt5/qtassistant/images/assistant-preferences-documentation.png
  1757. share/doc/qt5/qtassistant/images/assistant-preferences-filters.png
  1758. share/doc/qt5/qtassistant/images/assistant-preferences-fonts.png
  1759. share/doc/qt5/qtassistant/images/assistant-preferences-options.png
  1760. share/doc/qt5/qtassistant/images/assistant-search.png
  1761. share/doc/qt5/qtassistant/images/bgrContent.png
  1762. share/doc/qt5/qtassistant/images/btn_next.png
  1763. share/doc/qt5/qtassistant/images/btn_prev.png
  1764. share/doc/qt5/qtassistant/images/bullet_dn.png
  1765. share/doc/qt5/qtassistant/images/bullet_sq.png
  1766. share/doc/qt5/qtassistant/images/home.png
  1767. share/doc/qt5/qtassistant/images/ico_note.png
  1768. share/doc/qt5/qtassistant/images/ico_note_attention.png
  1769. share/doc/qt5/qtassistant/images/ico_out.png
  1770. share/doc/qt5/qtassistant/images/logo.png
  1771. share/doc/qt5/qtassistant/images/simpletextviewer-example.png
  1772. share/doc/qt5/qtassistant/images/simpletextviewer-findfiledialog.png
  1773. share/doc/qt5/qtassistant/images/simpletextviewer-mainwindow.png
  1774. share/doc/qt5/qtassistant/images/used-in-examples/remotecontrol/enter.png
  1775. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/browse.png
  1776. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/fadedfilemenu.png
  1777. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/filedialog.png
  1778. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/handbook.png
  1779. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/icon.png
  1780. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/mainwindow.png
  1781. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/open.png
  1782. share/doc/qt5/qtassistant/images/used-in-examples/simpletextviewer/documentation/images/wildcard.png
  1783. share/doc/qt5/qtassistant/qtassistant-index.html
  1784. share/doc/qt5/qtassistant/qtassistant-remotecontrol-example.html
  1785. share/doc/qt5/qtassistant/qtassistant-remotecontrol-main-cpp.html
  1786. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-cpp.html
  1787. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-h.html
  1788. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-pro.html
  1789. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-qrc.html
  1790. share/doc/qt5/qtassistant/qtassistant-remotecontrol-remotecontrol-ui.html
  1791. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-cpp.html
  1792. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-assistant-h.html
  1793. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhcp.html
  1794. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-documentation-simpletextviewer-qhp.html
  1795. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-example.html
  1796. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-cpp.html
  1797. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-findfiledialog-h.html
  1798. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-main-cpp.html
  1799. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-cpp.html
  1800. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-mainwindow-h.html
  1801. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-simpletextviewer-pro.html
  1802. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-cpp.html
  1803. share/doc/qt5/qtassistant/qtassistant-simpletextviewer-textedit-h.html
  1804. share/doc/qt5/qtassistant/qtassistant.index
  1805. share/doc/qt5/qtassistant/qtassistant.qhp
  1806. share/doc/qt5/qtassistant/qtassistant.qhp.sha1
  1807. share/doc/qt5/qtassistant/style/offline-simple.css
  1808. share/doc/qt5/qtassistant/style/offline.css
  1809. share/doc/qt5/qtbluetooth.qch
  1810. share/doc/qt5/qtbluetooth/bluetooth-examples.html
  1811. share/doc/qt5/qtbluetooth/examples-manifest.xml
  1812. share/doc/qt5/qtbluetooth/images/arrow_bc.png
  1813. share/doc/qt5/qtbluetooth/images/bgrContent.png
  1814. share/doc/qt5/qtbluetooth/images/btchat-example.png
  1815. share/doc/qt5/qtbluetooth/images/btfiletransfer-example.png
  1816. share/doc/qt5/qtbluetooth/images/btn_next.png
  1817. share/doc/qt5/qtbluetooth/images/btn_prev.png
  1818. share/doc/qt5/qtbluetooth/images/btscanner-example.png
  1819. share/doc/qt5/qtbluetooth/images/bullet_dn.png
  1820. share/doc/qt5/qtbluetooth/images/bullet_sq.png
  1821. share/doc/qt5/qtbluetooth/images/chat-view.png
  1822. share/doc/qt5/qtbluetooth/images/devicescan.png
  1823. share/doc/qt5/qtbluetooth/images/heartgame-result.png
  1824. share/doc/qt5/qtbluetooth/images/heartgame-running.png
  1825. share/doc/qt5/qtbluetooth/images/heartgame-search.png
  1826. share/doc/qt5/qtbluetooth/images/heartgame-start.png
  1827. share/doc/qt5/qtbluetooth/images/home.png
  1828. share/doc/qt5/qtbluetooth/images/ico_note.png
  1829. share/doc/qt5/qtbluetooth/images/ico_note_attention.png
  1830. share/doc/qt5/qtbluetooth/images/ico_out.png
  1831. share/doc/qt5/qtbluetooth/images/intro.png
  1832. share/doc/qt5/qtbluetooth/images/intro1.png
  1833. share/doc/qt5/qtbluetooth/images/logo.png
  1834. share/doc/qt5/qtbluetooth/images/lowenergyscanner-chars.png
  1835. share/doc/qt5/qtbluetooth/images/lowenergyscanner-devices.png
  1836. share/doc/qt5/qtbluetooth/images/lowenergyscanner-services.png
  1837. share/doc/qt5/qtbluetooth/images/opp-example-1.png
  1838. share/doc/qt5/qtbluetooth/images/opp-example-2.png
  1839. share/doc/qt5/qtbluetooth/images/opp-example-3.png
  1840. share/doc/qt5/qtbluetooth/images/peripheral-structure.png
  1841. share/doc/qt5/qtbluetooth/images/servicescan.png
  1842. share/doc/qt5/qtbluetooth/images/used-in-examples/btfiletransfer/busy.gif
  1843. share/doc/qt5/qtbluetooth/images/used-in-examples/btfiletransfer/pairing.gif
  1844. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/clear.png
  1845. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/default.png
  1846. share/doc/qt5/qtbluetooth/images/used-in-examples/chat/images/lineedit-bg.png
  1847. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/bt_off_to_on.png
  1848. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/heart.png
  1849. share/doc/qt5/qtbluetooth/images/used-in-examples/heartrate-game/qml/images/logo.png
  1850. share/doc/qt5/qtbluetooth/images/used-in-examples/lowenergyscanner/assets/busy_dark.png
  1851. share/doc/qt5/qtbluetooth/images/used-in-examples/picturetransfer/background.png
  1852. share/doc/qt5/qtbluetooth/images/used-in-examples/picturetransfer/icon.png
  1853. share/doc/qt5/qtbluetooth/images/used-in-examples/scanner/default.png
  1854. share/doc/qt5/qtbluetooth/qbluetooth.html
  1855. share/doc/qt5/qtbluetooth/qbluetoothaddress-members.html
  1856. share/doc/qt5/qtbluetooth/qbluetoothaddress.html
  1857. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
  1858. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent-obsolete.html
  1859. share/doc/qt5/qtbluetooth/qbluetoothdevicediscoveryagent.html
  1860. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo-members.html
  1861. share/doc/qt5/qtbluetooth/qbluetoothdeviceinfo.html
  1862. share/doc/qt5/qtbluetooth/qbluetoothhostinfo-members.html
  1863. share/doc/qt5/qtbluetooth/qbluetoothhostinfo.html
  1864. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice-members.html
  1865. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice-obsolete.html
  1866. share/doc/qt5/qtbluetooth/qbluetoothlocaldevice.html
  1867. share/doc/qt5/qtbluetooth/qbluetoothserver-members.html
  1868. share/doc/qt5/qtbluetooth/qbluetoothserver-obsolete.html
  1869. share/doc/qt5/qtbluetooth/qbluetoothserver.html
  1870. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent-members.html
  1871. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent-obsolete.html
  1872. share/doc/qt5/qtbluetooth/qbluetoothservicediscoveryagent.html
  1873. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
  1874. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-alternative.html
  1875. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-members.html
  1876. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
  1877. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo-sequence.html
  1878. share/doc/qt5/qtbluetooth/qbluetoothserviceinfo.html
  1879. share/doc/qt5/qtbluetooth/qbluetoothsocket-members.html
  1880. share/doc/qt5/qtbluetooth/qbluetoothsocket-obsolete.html
  1881. share/doc/qt5/qtbluetooth/qbluetoothsocket.html
  1882. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager-members.html
  1883. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager-obsolete.html
  1884. share/doc/qt5/qtbluetooth/qbluetoothtransfermanager.html
  1885. share/doc/qt5/qtbluetooth/qbluetoothtransferreply-members.html
  1886. share/doc/qt5/qtbluetooth/qbluetoothtransferreply-obsolete.html
  1887. share/doc/qt5/qtbluetooth/qbluetoothtransferreply.html
  1888. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest-members.html
  1889. share/doc/qt5/qtbluetooth/qbluetoothtransferrequest.html
  1890. share/doc/qt5/qtbluetooth/qbluetoothuuid-members.html
  1891. share/doc/qt5/qtbluetooth/qbluetoothuuid.html
  1892. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata-members.html
  1893. share/doc/qt5/qtbluetooth/qlowenergyadvertisingdata.html
  1894. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
  1895. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
  1896. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters-members.html
  1897. share/doc/qt5/qtbluetooth/qlowenergyadvertisingparameters.html
  1898. share/doc/qt5/qtbluetooth/qlowenergycharacteristic-members.html
  1899. share/doc/qt5/qtbluetooth/qlowenergycharacteristic.html
  1900. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata-members.html
  1901. share/doc/qt5/qtbluetooth/qlowenergycharacteristicdata.html
  1902. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters-members.html
  1903. share/doc/qt5/qtbluetooth/qlowenergyconnectionparameters.html
  1904. share/doc/qt5/qtbluetooth/qlowenergycontroller-members.html
  1905. share/doc/qt5/qtbluetooth/qlowenergycontroller-obsolete.html
  1906. share/doc/qt5/qtbluetooth/qlowenergycontroller.html
  1907. share/doc/qt5/qtbluetooth/qlowenergydescriptor-members.html
  1908. share/doc/qt5/qtbluetooth/qlowenergydescriptor.html
  1909. share/doc/qt5/qtbluetooth/qlowenergydescriptordata-members.html
  1910. share/doc/qt5/qtbluetooth/qlowenergydescriptordata.html
  1911. share/doc/qt5/qtbluetooth/qlowenergyservice-members.html
  1912. share/doc/qt5/qtbluetooth/qlowenergyservice-obsolete.html
  1913. share/doc/qt5/qtbluetooth/qlowenergyservice.html
  1914. share/doc/qt5/qtbluetooth/qlowenergyservicedata-members.html
  1915. share/doc/qt5/qtbluetooth/qlowenergyservicedata.html
  1916. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
  1917. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
  1918. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
  1919. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
  1920. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
  1921. share/doc/qt5/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
  1922. share/doc/qt5/qtbluetooth/qtbluetooth-attribution-bluez.html
  1923. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-btchat-pro.html
  1924. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-cpp.html
  1925. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-h.html
  1926. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chat-ui.html
  1927. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-cpp.html
  1928. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatclient-h.html
  1929. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-cpp.html
  1930. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-chatserver-h.html
  1931. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-example.html
  1932. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-main-cpp.html
  1933. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-cpp.html
  1934. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-h.html
  1935. share/doc/qt5/qtbluetooth/qtbluetooth-btchat-remoteselector-ui.html
  1936. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-pro.html
  1937. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-btfiletransfer-qrc.html
  1938. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-example.html
  1939. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-main-cpp.html
  1940. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-cpp.html
  1941. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-h.html
  1942. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-pindisplay-ui.html
  1943. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-cpp.html
  1944. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-h.html
  1945. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-progress-ui.html
  1946. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-cpp.html
  1947. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-h.html
  1948. share/doc/qt5/qtbluetooth/qtbluetooth-btfiletransfer-remoteselector-ui.html
  1949. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-btscanner-pro.html
  1950. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-cpp.html
  1951. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-h.html
  1952. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-device-ui.html
  1953. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-example.html
  1954. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-main-cpp.html
  1955. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-cpp.html
  1956. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-h.html
  1957. share/doc/qt5/qtbluetooth/qtbluetooth-btscanner-service-ui.html
  1958. share/doc/qt5/qtbluetooth/qtbluetooth-chat-button-qml.html
  1959. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-pro.html
  1960. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qml.html
  1961. share/doc/qt5/qtbluetooth/qtbluetooth-chat-chat-qrc.html
  1962. share/doc/qt5/qtbluetooth/qtbluetooth-chat-example.html
  1963. share/doc/qt5/qtbluetooth/qtbluetooth-chat-inputbox-qml.html
  1964. share/doc/qt5/qtbluetooth/qtbluetooth-chat-qmlchat-cpp.html
  1965. share/doc/qt5/qtbluetooth/qtbluetooth-chat-search-qml.html
  1966. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-cpp.html
  1967. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-bluetoothbaseclass-h.html
  1968. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-cpp.html
  1969. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-connectionhandler-h.html
  1970. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-cpp.html
  1971. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicefinder-h.html
  1972. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-cpp.html
  1973. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-devicehandler-h.html
  1974. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-cpp.html
  1975. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-deviceinfo-h.html
  1976. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-example.html
  1977. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-game-pro.html
  1978. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-heartrate-global-h.html
  1979. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-images-qrc.html
  1980. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-main-cpp.html
  1981. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-app-qml.html
  1982. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bluetoothalarmdialog-qml.html
  1983. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-bottomline-qml.html
  1984. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-connect-qml.html
  1985. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamebutton-qml.html
  1986. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamepage-qml.html
  1987. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-gamesettings-qml.html
  1988. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-main-qml.html
  1989. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-measure-qml.html
  1990. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qmldir.html
  1991. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-qrc.html
  1992. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-splashscreen-qml.html
  1993. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-stats-qml.html
  1994. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-statslabel-qml.html
  1995. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-game-qml-titlebar-qml.html
  1996. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-example.html
  1997. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-heartrate-server-pro.html
  1998. share/doc/qt5/qtbluetooth/qtbluetooth-heartrate-server-main-cpp.html
  1999. share/doc/qt5/qtbluetooth/qtbluetooth-index.html
  2000. share/doc/qt5/qtbluetooth/qtbluetooth-le-overview.html
  2001. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-characteristics-qml.html
  2002. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-dialog-qml.html
  2003. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-header-qml.html
  2004. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-label-qml.html
  2005. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-main-qml.html
  2006. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-menu-qml.html
  2007. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-assets-services-qml.html
  2008. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-cpp.html
  2009. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-characteristicinfo-h.html
  2010. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-cpp.html
  2011. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-device-h.html
  2012. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-cpp.html
  2013. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-deviceinfo-h.html
  2014. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
  2015. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-lowenergyscanner-pro.html
  2016. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-main-cpp.html
  2017. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-resources-qrc.html
  2018. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-cpp.html
  2019. share/doc/qt5/qtbluetooth/qtbluetooth-lowenergyscanner-serviceinfo-h.html
  2020. share/doc/qt5/qtbluetooth/qtbluetooth-module.html
  2021. share/doc/qt5/qtbluetooth/qtbluetooth-overview.html
  2022. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-bttransfer-qml.html
  2023. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-button-qml.html
  2024. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-devicediscovery-qml.html
  2025. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-example.html
  2026. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filesending-qml.html
  2027. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-cpp.html
  2028. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-filetransfer-h.html
  2029. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-main-cpp.html
  2030. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-pictureselector-qml.html
  2031. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-picturetransfer-pro.html
  2032. share/doc/qt5/qtbluetooth/qtbluetooth-picturetransfer-qmltransfer-qrc.html
  2033. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-board-qml.html
  2034. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-dialog-qml.html
  2035. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-main-qml.html
  2036. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-assets-menu-qml.html
  2037. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-example.html
  2038. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-main-cpp.html
  2039. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-cpp.html
  2040. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-h.html
  2041. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-pingpong-pro.html
  2042. share/doc/qt5/qtbluetooth/qtbluetooth-pingpong-resource-qrc.html
  2043. share/doc/qt5/qtbluetooth/qtbluetooth-qmlmodule.html
  2044. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-button-qml.html
  2045. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-example.html
  2046. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-qmlscanner-cpp.html
  2047. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-pro.html
  2048. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qml.html
  2049. share/doc/qt5/qtbluetooth/qtbluetooth-scanner-scanner-qrc.html
  2050. share/doc/qt5/qtbluetooth/qtbluetooth.index
  2051. share/doc/qt5/qtbluetooth/qtbluetooth.qhp
  2052. share/doc/qt5/qtbluetooth/qtbluetooth.qhp.sha1
  2053. share/doc/qt5/qtbluetooth/qtbluetooth.tags
  2054. share/doc/qt5/qtbluetooth/style/offline-simple.css
  2055. share/doc/qt5/qtbluetooth/style/offline.css
  2056. share/doc/qt5/qtcanvas3d.qch
  2057. share/doc/qt5/qtcanvas3d/examples-manifest.xml
  2058. share/doc/qt5/qtcanvas3d/images/arrow_bc.png
  2059. share/doc/qt5/qtcanvas3d/images/bgrContent.png
  2060. share/doc/qt5/qtcanvas3d/images/btn_next.png
  2061. share/doc/qt5/qtcanvas3d/images/btn_prev.png
  2062. share/doc/qt5/qtcanvas3d/images/bullet_dn.png
  2063. share/doc/qt5/qtcanvas3d/images/bullet_sq.png
  2064. share/doc/qt5/qtcanvas3d/images/cellphone-example.png
  2065. share/doc/qt5/qtcanvas3d/images/framebuffer-example.png
  2066. share/doc/qt5/qtcanvas3d/images/home.png
  2067. share/doc/qt5/qtcanvas3d/images/ico_note.png
  2068. share/doc/qt5/qtcanvas3d/images/ico_note_attention.png
  2069. share/doc/qt5/qtcanvas3d/images/ico_out.png
  2070. share/doc/qt5/qtcanvas3d/images/interaction-example.png
  2071. share/doc/qt5/qtcanvas3d/images/jsonmodels-example.png
  2072. share/doc/qt5/qtcanvas3d/images/logo.png
  2073. share/doc/qt5/qtcanvas3d/images/oneqt-example.png
  2074. share/doc/qt5/qtcanvas3d/images/planets-example.jpg
  2075. share/doc/qt5/qtcanvas3d/images/quickitemtexture-example.png
  2076. share/doc/qt5/qtcanvas3d/images/textureandlight-example.png
  2077. share/doc/qt5/qtcanvas3d/images/used-in-examples/framebuffer/qml/framebuffer/qtlogo.png
  2078. share/doc/qt5/qtcanvas3d/images/used-in-examples/interaction/qml/interaction/barrel.jpg
  2079. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/bush.png
  2080. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/gold.jpg
  2081. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/pallet.jpg
  2082. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/rock.jpg
  2083. share/doc/qt5/qtcanvas3d/images/used-in-examples/jsonmodels/qml/jsonmodels/woodbox.jpg
  2084. share/doc/qt5/qtcanvas3d/images/used-in-examples/textureandlight/qml/textureandlight/qtlogo.png
  2085. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/calendar.png
  2086. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/camera.png
  2087. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/clock.png
  2088. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/contacts.png
  2089. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/gallery.png
  2090. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/games.png
  2091. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/lock.png
  2092. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/mail.png
  2093. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/maps.png
  2094. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/menu_background.jpg
  2095. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/music.png
  2096. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/plutomap1k.jpg
  2097. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/qtlogo_with_alpha.png
  2098. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/settings.png
  2099. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/todo.png
  2100. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/cellphone/images/videos.png
  2101. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29.png
  2102. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x.png
  2103. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29@2x~ipad.png
  2104. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon29x29~ipad.png
  2105. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x.png
  2106. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40@2x~ipad.png
  2107. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon40x40~ipad.png
  2108. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50@2x~ipad.png
  2109. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon50x50~ipad.png
  2110. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57.png
  2111. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon57x57@2x.png
  2112. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon60x60@2x.png
  2113. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72@2x~ipad.png
  2114. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon72x72~ipad.png
  2115. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76@2x~ipad.png
  2116. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/ios/OneQtIcon76x76~ipad.png
  2117. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/dataviz.jpg
  2118. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/devices.png
  2119. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/embedded.png
  2120. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/iot.png
  2121. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/multiscreen.png
  2122. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/puzzle-pieces.png
  2123. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogo.png
  2124. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/oneqt/textures/qtlogosmall.png
  2125. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earth.png
  2126. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthbump1k.jpg
  2127. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthcloudmapcolortrans.png
  2128. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthmap1k.jpg
  2129. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/earthspec1k.jpg
  2130. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/galaxy_starfield.png
  2131. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupiter.png
  2132. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/jupitermap.jpg
  2133. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mars.png
  2134. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsbump1k.jpg
  2135. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/marsmap1k.jpg
  2136. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercury.png
  2137. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurybump.jpg
  2138. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/mercurymap.jpg
  2139. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonbump1k.jpg
  2140. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/moonmap1k.jpg
  2141. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptune.png
  2142. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/neptunemap.jpg
  2143. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutobump1k.jpg
  2144. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/plutomap1k.jpg
  2145. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturn.png
  2146. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnmap.jpg
  2147. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/saturnringcolortrans.png
  2148. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sun.png
  2149. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/sunmap.jpg
  2150. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranus.png
  2151. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusmap.jpg
  2152. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/uranusringcolortrans.png
  2153. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venus.png
  2154. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusbump.jpg
  2155. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/images/venusmap.jpg
  2156. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29.png
  2157. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x.png
  2158. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29@2x~ipad.png
  2159. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon29x29~ipad.png
  2160. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x.png
  2161. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40@2x~ipad.png
  2162. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon40x40~ipad.png
  2163. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50@2x~ipad.png
  2164. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon50x50~ipad.png
  2165. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57.png
  2166. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon57x57@2x.png
  2167. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon60x60@2x.png
  2168. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72@2x~ipad.png
  2169. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon72x72~ipad.png
  2170. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76@2x~ipad.png
  2171. share/doc/qt5/qtcanvas3d/images/used-in-examples/threejs/planets/ios/AppIcon76x76~ipad.png
  2172. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d-members.html
  2173. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3d.html
  2174. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject-members.html
  2175. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dabstractobject.html
  2176. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo-members.html
  2177. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dactiveinfo.html
  2178. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer-members.html
  2179. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dbuffer.html
  2180. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes-members.html
  2181. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dcontextattributes.html
  2182. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer-members.html
  2183. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dframebuffer.html
  2184. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram-members.html
  2185. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dprogram.html
  2186. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer-members.html
  2187. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3drenderbuffer.html
  2188. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader-members.html
  2189. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshader.html
  2190. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat-members.html
  2191. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dshaderprecisionformat.html
  2192. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture-members.html
  2193. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtexture.html
  2194. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider-members.html
  2195. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3dtextureprovider.html
  2196. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation-members.html
  2197. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-canvas3duniformlocation.html
  2198. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d-members.html
  2199. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-context3d.html
  2200. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext-members.html
  2201. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-glstatedumpext.html
  2202. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage-members.html
  2203. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimage.html
  2204. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory-members.html
  2205. share/doc/qt5/qtcanvas3d/qml-qtcanvas3d-textureimagefactory.html
  2206. share/doc/qt5/qtcanvas3d/qtcanvas3d-conformance-issues-html.html
  2207. share/doc/qt5/qtcanvas3d/qtcanvas3d-examples.html
  2208. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-example.html
  2209. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-pro.html
  2210. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-framebuffer-qrc.html
  2211. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-main-cpp.html
  2212. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-framebuffer-js.html
  2213. share/doc/qt5/qtcanvas3d/qtcanvas3d-framebuffer-qml-framebuffer-main-qml.html
  2214. share/doc/qt5/qtcanvas3d/qtcanvas3d-getting-started.html
  2215. share/doc/qt5/qtcanvas3d/qtcanvas3d-index.html
  2216. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-example.html
  2217. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-pro.html
  2218. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-interaction-qrc.html
  2219. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-main-cpp.html
  2220. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-interaction-js.html
  2221. share/doc/qt5/qtcanvas3d/qtcanvas3d-interaction-qml-interaction-main-qml.html
  2222. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-example.html
  2223. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-jsonmodels-pro.html
  2224. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-main-cpp.html
  2225. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-js.html
  2226. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-jsonmodels-jsonmodels-qml.html
  2227. share/doc/qt5/qtcanvas3d/qtcanvas3d-jsonmodels-qml-qrc.html
  2228. share/doc/qt5/qtcanvas3d/qtcanvas3d-logging.html
  2229. share/doc/qt5/qtcanvas3d/qtcanvas3d-qmlmodule-obsolete.html
  2230. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-example.html
  2231. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-main-cpp.html
  2232. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-main-qml.html
  2233. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-qml-quickitemtexture-quickitemtexture-js.html
  2234. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-pro.html
  2235. share/doc/qt5/qtcanvas3d/qtcanvas3d-quickitemtexture-quickitemtexture-qrc.html
  2236. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-example.html
  2237. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-main-cpp.html
  2238. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-main-qml.html
  2239. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-qml-textureandlight-textureandlight-js.html
  2240. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-pro.html
  2241. share/doc/qt5/qtcanvas3d/qtcanvas3d-textureandlight-textureandlight-qrc.html
  2242. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-pro.html
  2243. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-cellphone-qrc.html
  2244. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-example.html
  2245. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-main-cpp.html
  2246. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphone-js.html
  2247. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphoneapp-qml.html
  2248. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-cellphonecanvas-qml.html
  2249. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-colorselector-qml.html
  2250. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-fpsdisplay-qml.html
  2251. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-cellphone-qml-cellphone-main-qml.html
  2252. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-example.html
  2253. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-js.html
  2254. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-imagecube-qml.html
  2255. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-infosheet-qml.html
  2256. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-main-cpp.html
  2257. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-navibutton-qml.html
  2258. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-pro.html
  2259. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qml.html
  2260. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-oneqt-qrc.html
  2261. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-oneqt-swipearea-qml.html
  2262. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-example.html
  2263. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-fpsdisplay-qml.html
  2264. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-infosheet-qml.html
  2265. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-main-cpp.html
  2266. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planetbutton-qml.html
  2267. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-js.html
  2268. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-pro.html
  2269. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qml.html
  2270. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-planets-qrc.html
  2271. share/doc/qt5/qtcanvas3d/qtcanvas3d-threejs-planets-styledslider-qml.html
  2272. share/doc/qt5/qtcanvas3d/qtcanvas3d.index
  2273. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp
  2274. share/doc/qt5/qtcanvas3d/qtcanvas3d.qhp.sha1
  2275. share/doc/qt5/qtcanvas3d/style/offline-simple.css
  2276. share/doc/qt5/qtcanvas3d/style/offline.css
  2277. share/doc/qt5/qtconcurrent.qch
  2278. share/doc/qt5/qtconcurrent/examples-manifest.xml
  2279. share/doc/qt5/qtconcurrent/images/arrow_bc.png
  2280. share/doc/qt5/qtconcurrent/images/bgrContent.png
  2281. share/doc/qt5/qtconcurrent/images/btn_next.png
  2282. share/doc/qt5/qtconcurrent/images/btn_prev.png
  2283. share/doc/qt5/qtconcurrent/images/bullet_dn.png
  2284. share/doc/qt5/qtconcurrent/images/bullet_sq.png
  2285. share/doc/qt5/qtconcurrent/images/home.png
  2286. share/doc/qt5/qtconcurrent/images/ico_note.png
  2287. share/doc/qt5/qtconcurrent/images/ico_note_attention.png
  2288. share/doc/qt5/qtconcurrent/images/ico_out.png
  2289. share/doc/qt5/qtconcurrent/images/imagescaling_example.png
  2290. share/doc/qt5/qtconcurrent/images/logo.png
  2291. share/doc/qt5/qtconcurrent/images/qtconcurrent-progressdialog.png
  2292. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-example.html
  2293. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-cpp.html
  2294. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-h.html
  2295. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-imagescaling-pro.html
  2296. share/doc/qt5/qtconcurrent/qtconcurrent-imagescaling-main-cpp.html
  2297. share/doc/qt5/qtconcurrent/qtconcurrent-index.html
  2298. share/doc/qt5/qtconcurrent/qtconcurrent-intermediateresults-members.html
  2299. share/doc/qt5/qtconcurrent/qtconcurrent-intermediateresults.html
  2300. share/doc/qt5/qtconcurrent/qtconcurrent-map-example.html
  2301. share/doc/qt5/qtconcurrent/qtconcurrent-map-main-cpp.html
  2302. share/doc/qt5/qtconcurrent/qtconcurrent-map-map-pro.html
  2303. share/doc/qt5/qtconcurrent/qtconcurrent-module.html
  2304. share/doc/qt5/qtconcurrent/qtconcurrent-obsolete.html
  2305. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-example.html
  2306. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-main-cpp.html
  2307. share/doc/qt5/qtconcurrent/qtconcurrent-progressdialog-progressdialog-pro.html
  2308. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-example.html
  2309. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-main-cpp.html
  2310. share/doc/qt5/qtconcurrent/qtconcurrent-runfunction-runfunction-pro.html
  2311. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-example.html
  2312. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-main-cpp.html
  2313. share/doc/qt5/qtconcurrent/qtconcurrent-wordcount-wordcount-pro.html
  2314. share/doc/qt5/qtconcurrent/qtconcurrent.html
  2315. share/doc/qt5/qtconcurrent/qtconcurrent.index
  2316. share/doc/qt5/qtconcurrent/qtconcurrent.qhp
  2317. share/doc/qt5/qtconcurrent/qtconcurrent.qhp.sha1
  2318. share/doc/qt5/qtconcurrent/qtconcurrent.tags
  2319. share/doc/qt5/qtconcurrent/qtconcurrentfilter.html
  2320. share/doc/qt5/qtconcurrent/qtconcurrentmap.html
  2321. share/doc/qt5/qtconcurrent/qtconcurrentrun.html
  2322. share/doc/qt5/qtconcurrent/style/offline-simple.css
  2323. share/doc/qt5/qtconcurrent/style/offline.css
  2324. share/doc/qt5/qtcore.qch
  2325. share/doc/qt5/qtcore/animation-overview.html
  2326. share/doc/qt5/qtcore/animation.html
  2327. share/doc/qt5/qtcore/codec-big5.html
  2328. share/doc/qt5/qtcore/codec-big5hkscs.html
  2329. share/doc/qt5/qtcore/codec-eucjp.html
  2330. share/doc/qt5/qtcore/codec-euckr.html
  2331. share/doc/qt5/qtcore/codec-gbk.html
  2332. share/doc/qt5/qtcore/codec-sjis.html
  2333. share/doc/qt5/qtcore/codec-tscii.html
  2334. share/doc/qt5/qtcore/codecs-jis.html
  2335. share/doc/qt5/qtcore/containers.html
  2336. share/doc/qt5/qtcore/custom-types.html
  2337. share/doc/qt5/qtcore/datastreamformat.html
  2338. share/doc/qt5/qtcore/events.html
  2339. share/doc/qt5/qtcore/eventsandfilters.html
  2340. share/doc/qt5/qtcore/examples-manifest.xml
  2341. share/doc/qt5/qtcore/images/abstract-connections.png
  2342. share/doc/qt5/qtcore/images/animations-architecture.png
  2343. share/doc/qt5/qtcore/images/arrow_bc.png
  2344. share/doc/qt5/qtcore/images/bgrContent.png
  2345. share/doc/qt5/qtcore/images/brush-styles.png
  2346. share/doc/qt5/qtcore/images/btn_next.png
  2347. share/doc/qt5/qtcore/images/btn_prev.png
  2348. share/doc/qt5/qtcore/images/bullet_dn.png
  2349. share/doc/qt5/qtcore/images/bullet_sq.png
  2350. share/doc/qt5/qtcore/images/cursor-arrow.png
  2351. share/doc/qt5/qtcore/images/cursor-busy.png
  2352. share/doc/qt5/qtcore/images/cursor-closedhand.png
  2353. share/doc/qt5/qtcore/images/cursor-cross.png
  2354. share/doc/qt5/qtcore/images/cursor-forbidden.png
  2355. share/doc/qt5/qtcore/images/cursor-hand.png
  2356. share/doc/qt5/qtcore/images/cursor-hsplit.png
  2357. share/doc/qt5/qtcore/images/cursor-ibeam.png
  2358. share/doc/qt5/qtcore/images/cursor-openhand.png
  2359. share/doc/qt5/qtcore/images/cursor-sizeall.png
  2360. share/doc/qt5/qtcore/images/cursor-sizeb.png
  2361. share/doc/qt5/qtcore/images/cursor-sizef.png
  2362. share/doc/qt5/qtcore/images/cursor-sizeh.png
  2363. share/doc/qt5/qtcore/images/cursor-sizev.png
  2364. share/doc/qt5/qtcore/images/cursor-uparrow.png
  2365. share/doc/qt5/qtcore/images/cursor-vsplit.png
  2366. share/doc/qt5/qtcore/images/cursor-wait.png
  2367. share/doc/qt5/qtcore/images/cursor-whatsthis.png
  2368. share/doc/qt5/qtcore/images/home.png
  2369. share/doc/qt5/qtcore/images/ico_note.png
  2370. share/doc/qt5/qtcore/images/ico_note_attention.png
  2371. share/doc/qt5/qtcore/images/ico_out.png
  2372. share/doc/qt5/qtcore/images/javaiterators1.png
  2373. share/doc/qt5/qtcore/images/javaiterators2.png
  2374. share/doc/qt5/qtcore/images/localfortuneclient-example.png
  2375. share/doc/qt5/qtcore/images/localfortuneserver-example.png
  2376. share/doc/qt5/qtcore/images/logo.png
  2377. share/doc/qt5/qtcore/images/mandelbrot-example.png
  2378. share/doc/qt5/qtcore/images/mandelbrot_scroll1.png
  2379. share/doc/qt5/qtcore/images/mandelbrot_scroll2.png
  2380. share/doc/qt5/qtcore/images/mandelbrot_scroll3.png
  2381. share/doc/qt5/qtcore/images/mandelbrot_zoom1.png
  2382. share/doc/qt5/qtcore/images/mandelbrot_zoom2.png
  2383. share/doc/qt5/qtcore/images/mandelbrot_zoom3.png
  2384. share/doc/qt5/qtcore/images/mimetypebrowser.png
  2385. share/doc/qt5/qtcore/images/modelindex-no-parent.png
  2386. share/doc/qt5/qtcore/images/modelview-begin-append-columns.png
  2387. share/doc/qt5/qtcore/images/modelview-begin-append-rows.png
  2388. share/doc/qt5/qtcore/images/modelview-begin-insert-columns.png
  2389. share/doc/qt5/qtcore/images/modelview-begin-insert-rows.png
  2390. share/doc/qt5/qtcore/images/modelview-begin-remove-columns.png
  2391. share/doc/qt5/qtcore/images/modelview-begin-remove-rows.png
  2392. share/doc/qt5/qtcore/images/modelview-move-rows-1.png
  2393. share/doc/qt5/qtcore/images/modelview-move-rows-2.png
  2394. share/doc/qt5/qtcore/images/modelview-move-rows-3.png
  2395. share/doc/qt5/qtcore/images/modelview-move-rows-4.png
  2396. share/doc/qt5/qtcore/images/qeasingcurve-inback.png
  2397. share/doc/qt5/qtcore/images/qeasingcurve-inbounce.png
  2398. share/doc/qt5/qtcore/images/qeasingcurve-incirc.png
  2399. share/doc/qt5/qtcore/images/qeasingcurve-incubic.png
  2400. share/doc/qt5/qtcore/images/qeasingcurve-inelastic.png
  2401. share/doc/qt5/qtcore/images/qeasingcurve-inexpo.png
  2402. share/doc/qt5/qtcore/images/qeasingcurve-inoutback.png
  2403. share/doc/qt5/qtcore/images/qeasingcurve-inoutbounce.png
  2404. share/doc/qt5/qtcore/images/qeasingcurve-inoutcirc.png
  2405. share/doc/qt5/qtcore/images/qeasingcurve-inoutcubic.png
  2406. share/doc/qt5/qtcore/images/qeasingcurve-inoutelastic.png
  2407. share/doc/qt5/qtcore/images/qeasingcurve-inoutexpo.png
  2408. share/doc/qt5/qtcore/images/qeasingcurve-inoutquad.png
  2409. share/doc/qt5/qtcore/images/qeasingcurve-inoutquart.png
  2410. share/doc/qt5/qtcore/images/qeasingcurve-inoutquint.png
  2411. share/doc/qt5/qtcore/images/qeasingcurve-inoutsine.png
  2412. share/doc/qt5/qtcore/images/qeasingcurve-inquad.png
  2413. share/doc/qt5/qtcore/images/qeasingcurve-inquart.png
  2414. share/doc/qt5/qtcore/images/qeasingcurve-inquint.png
  2415. share/doc/qt5/qtcore/images/qeasingcurve-insine.png
  2416. share/doc/qt5/qtcore/images/qeasingcurve-linear.png
  2417. share/doc/qt5/qtcore/images/qeasingcurve-outback.png
  2418. share/doc/qt5/qtcore/images/qeasingcurve-outbounce.png
  2419. share/doc/qt5/qtcore/images/qeasingcurve-outcirc.png
  2420. share/doc/qt5/qtcore/images/qeasingcurve-outcubic.png
  2421. share/doc/qt5/qtcore/images/qeasingcurve-outelastic.png
  2422. share/doc/qt5/qtcore/images/qeasingcurve-outexpo.png
  2423. share/doc/qt5/qtcore/images/qeasingcurve-outinback.png
  2424. share/doc/qt5/qtcore/images/qeasingcurve-outinbounce.png
  2425. share/doc/qt5/qtcore/images/qeasingcurve-outincirc.png
  2426. share/doc/qt5/qtcore/images/qeasingcurve-outincubic.png
  2427. share/doc/qt5/qtcore/images/qeasingcurve-outinelastic.png
  2428. share/doc/qt5/qtcore/images/qeasingcurve-outinexpo.png
  2429. share/doc/qt5/qtcore/images/qeasingcurve-outinquad.png
  2430. share/doc/qt5/qtcore/images/qeasingcurve-outinquart.png
  2431. share/doc/qt5/qtcore/images/qeasingcurve-outinquint.png
  2432. share/doc/qt5/qtcore/images/qeasingcurve-outinsine.png
  2433. share/doc/qt5/qtcore/images/qeasingcurve-outquad.png
  2434. share/doc/qt5/qtcore/images/qeasingcurve-outquart.png
  2435. share/doc/qt5/qtcore/images/qeasingcurve-outquint.png
  2436. share/doc/qt5/qtcore/images/qeasingcurve-outsine.png
  2437. share/doc/qt5/qtcore/images/qimage-scaling.png
  2438. share/doc/qt5/qtcore/images/qline-coordinates.png
  2439. share/doc/qt5/qtcore/images/qline-point.png
  2440. share/doc/qt5/qtcore/images/qlinef-angle-identicaldirection.png
  2441. share/doc/qt5/qtcore/images/qlinef-angle-oppositedirection.png
  2442. share/doc/qt5/qtcore/images/qlinef-bounded.png
  2443. share/doc/qt5/qtcore/images/qlinef-normalvector.png
  2444. share/doc/qt5/qtcore/images/qlinef-unbounded.png
  2445. share/doc/qt5/qtcore/images/qpen-bevel.png
  2446. share/doc/qt5/qtcore/images/qpen-custom.png
  2447. share/doc/qt5/qtcore/images/qpen-dash.png
  2448. share/doc/qt5/qtcore/images/qpen-dashdot.png
  2449. share/doc/qt5/qtcore/images/qpen-dashdotdot.png
  2450. share/doc/qt5/qtcore/images/qpen-dot.png
  2451. share/doc/qt5/qtcore/images/qpen-flat.png
  2452. share/doc/qt5/qtcore/images/qpen-miter.png
  2453. share/doc/qt5/qtcore/images/qpen-roundcap.png
  2454. share/doc/qt5/qtcore/images/qpen-roundjoin.png
  2455. share/doc/qt5/qtcore/images/qpen-solid.png
  2456. share/doc/qt5/qtcore/images/qpen-square.png
  2457. share/doc/qt5/qtcore/images/qrect-coordinates.png
  2458. share/doc/qt5/qtcore/images/qrect-diagram-one.png
  2459. share/doc/qt5/qtcore/images/qrect-diagram-three.png
  2460. share/doc/qt5/qtcore/images/qrect-diagram-two.png
  2461. share/doc/qt5/qtcore/images/qrect-diagram-zero.png
  2462. share/doc/qt5/qtcore/images/qrect-intersect.png
  2463. share/doc/qt5/qtcore/images/qrect-unite.png
  2464. share/doc/qt5/qtcore/images/qrectf-coordinates.png
  2465. share/doc/qt5/qtcore/images/qrectf-diagram-one.png
  2466. share/doc/qt5/qtcore/images/qrectf-diagram-three.png
  2467. share/doc/qt5/qtcore/images/qrectf-diagram-two.png
  2468. share/doc/qt5/qtcore/images/qsortfilterproxymodel-sorting.png
  2469. share/doc/qt5/qtcore/images/queuedcustomtype-example.png
  2470. share/doc/qt5/qtcore/images/qurl-authority.png
  2471. share/doc/qt5/qtcore/images/qurl-authority2.png
  2472. share/doc/qt5/qtcore/images/qurl-authority3.png
  2473. share/doc/qt5/qtcore/images/qurl-fragment.png
  2474. share/doc/qt5/qtcore/images/qurl-ftppath.png
  2475. share/doc/qt5/qtcore/images/qurl-mailtopath.png
  2476. share/doc/qt5/qtcore/images/qurl-querystring.png
  2477. share/doc/qt5/qtcore/images/resources.png
  2478. share/doc/qt5/qtcore/images/sharedmemory-example_1.png
  2479. share/doc/qt5/qtcore/images/sharedmemory-example_2.png
  2480. share/doc/qt5/qtcore/images/statemachine-button-history.png
  2481. share/doc/qt5/qtcore/images/statemachine-button-nested.png
  2482. share/doc/qt5/qtcore/images/statemachine-button.png
  2483. share/doc/qt5/qtcore/images/statemachine-customevents.png
  2484. share/doc/qt5/qtcore/images/statemachine-customevents2.png
  2485. share/doc/qt5/qtcore/images/statemachine-finished.png
  2486. share/doc/qt5/qtcore/images/statemachine-nonparallel.png
  2487. share/doc/qt5/qtcore/images/statemachine-parallel.png
  2488. share/doc/qt5/qtcore/images/stliterators1.png
  2489. share/doc/qt5/qtcore/images/used-in-examples/ipc/sharedmemory/image.png
  2490. share/doc/qt5/qtcore/images/used-in-examples/ipc/sharedmemory/qt.png
  2491. share/doc/qt5/qtcore/implicit-sharing.html
  2492. share/doc/qt5/qtcore/io-functions.html
  2493. share/doc/qt5/qtcore/io.html
  2494. share/doc/qt5/qtcore/json.html
  2495. share/doc/qt5/qtcore/metaobjects.html
  2496. share/doc/qt5/qtcore/object.html
  2497. share/doc/qt5/qtcore/objecttrees.html
  2498. share/doc/qt5/qtcore/plugins.html
  2499. share/doc/qt5/qtcore/properties.html
  2500. share/doc/qt5/qtcore/qabstractanimation-members.html
  2501. share/doc/qt5/qtcore/qabstractanimation-obsolete.html
  2502. share/doc/qt5/qtcore/qabstractanimation.html
  2503. share/doc/qt5/qtcore/qabstracteventdispatcher-members.html
  2504. share/doc/qt5/qtcore/qabstracteventdispatcher-obsolete.html
  2505. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo-members.html
  2506. share/doc/qt5/qtcore/qabstracteventdispatcher-timerinfo.html
  2507. share/doc/qt5/qtcore/qabstracteventdispatcher.html
  2508. share/doc/qt5/qtcore/qabstractitemmodel-members.html
  2509. share/doc/qt5/qtcore/qabstractitemmodel-obsolete.html
  2510. share/doc/qt5/qtcore/qabstractitemmodel.html
  2511. share/doc/qt5/qtcore/qabstractlistmodel-members.html
  2512. share/doc/qt5/qtcore/qabstractlistmodel-obsolete.html
  2513. share/doc/qt5/qtcore/qabstractlistmodel.html
  2514. share/doc/qt5/qtcore/qabstractnativeeventfilter-members.html
  2515. share/doc/qt5/qtcore/qabstractnativeeventfilter.html
  2516. share/doc/qt5/qtcore/qabstractproxymodel-members.html
  2517. share/doc/qt5/qtcore/qabstractproxymodel-obsolete.html
  2518. share/doc/qt5/qtcore/qabstractproxymodel.html
  2519. share/doc/qt5/qtcore/qabstractstate-members.html
  2520. share/doc/qt5/qtcore/qabstractstate-obsolete.html
  2521. share/doc/qt5/qtcore/qabstractstate.html
  2522. share/doc/qt5/qtcore/qabstracttablemodel-members.html
  2523. share/doc/qt5/qtcore/qabstracttablemodel-obsolete.html
  2524. share/doc/qt5/qtcore/qabstracttablemodel.html
  2525. share/doc/qt5/qtcore/qabstracttransition-members.html
  2526. share/doc/qt5/qtcore/qabstracttransition-obsolete.html
  2527. share/doc/qt5/qtcore/qabstracttransition.html
  2528. share/doc/qt5/qtcore/qanimationgroup-members.html
  2529. share/doc/qt5/qtcore/qanimationgroup-obsolete.html
  2530. share/doc/qt5/qtcore/qanimationgroup.html
  2531. share/doc/qt5/qtcore/qassociativeiterable-const-iterator-members.html
  2532. share/doc/qt5/qtcore/qassociativeiterable-const-iterator.html
  2533. share/doc/qt5/qtcore/qassociativeiterable-members.html
  2534. share/doc/qt5/qtcore/qassociativeiterable.html
  2535. share/doc/qt5/qtcore/qatomicint-members.html
  2536. share/doc/qt5/qtcore/qatomicint.html
  2537. share/doc/qt5/qtcore/qatomicinteger-members.html
  2538. share/doc/qt5/qtcore/qatomicinteger.html
  2539. share/doc/qt5/qtcore/qatomicpointer-members.html
  2540. share/doc/qt5/qtcore/qatomicpointer.html
  2541. share/doc/qt5/qtcore/qbasictimer-members.html
  2542. share/doc/qt5/qtcore/qbasictimer.html
  2543. share/doc/qt5/qtcore/qbeinteger-members.html
  2544. share/doc/qt5/qtcore/qbeinteger.html
  2545. share/doc/qt5/qtcore/qbitarray-members.html
  2546. share/doc/qt5/qtcore/qbitarray.html
  2547. share/doc/qt5/qtcore/qbuffer-members.html
  2548. share/doc/qt5/qtcore/qbuffer-obsolete.html
  2549. share/doc/qt5/qtcore/qbuffer.html
  2550. share/doc/qt5/qtcore/qbytearray-members.html
  2551. share/doc/qt5/qtcore/qbytearray-obsolete.html
  2552. share/doc/qt5/qtcore/qbytearray.html
  2553. share/doc/qt5/qtcore/qbytearraylist-members.html
  2554. share/doc/qt5/qtcore/qbytearraylist.html
  2555. share/doc/qt5/qtcore/qbytearraymatcher-members.html
  2556. share/doc/qt5/qtcore/qbytearraymatcher.html
  2557. share/doc/qt5/qtcore/qcache-members.html
  2558. share/doc/qt5/qtcore/qcache.html
  2559. share/doc/qt5/qtcore/qcborarray-constiterator-members.html
  2560. share/doc/qt5/qtcore/qcborarray-constiterator.html
  2561. share/doc/qt5/qtcore/qcborarray-iterator-members.html
  2562. share/doc/qt5/qtcore/qcborarray-iterator.html
  2563. share/doc/qt5/qtcore/qcborarray-members.html
  2564. share/doc/qt5/qtcore/qcborarray.html
  2565. share/doc/qt5/qtcore/qcbormap-constiterator-members.html
  2566. share/doc/qt5/qtcore/qcbormap-constiterator.html
  2567. share/doc/qt5/qtcore/qcbormap-iterator-members.html
  2568. share/doc/qt5/qtcore/qcbormap-iterator.html
  2569. share/doc/qt5/qtcore/qcbormap-members.html
  2570. share/doc/qt5/qtcore/qcbormap.html
  2571. share/doc/qt5/qtcore/qcborparsererror-members.html
  2572. share/doc/qt5/qtcore/qcborparsererror.html
  2573. share/doc/qt5/qtcore/qcborstreamreader-members.html
  2574. share/doc/qt5/qtcore/qcborstreamreader-stringresult-members.html
  2575. share/doc/qt5/qtcore/qcborstreamreader-stringresult.html
  2576. share/doc/qt5/qtcore/qcborstreamreader.html
  2577. share/doc/qt5/qtcore/qcborstreamwriter-members.html
  2578. share/doc/qt5/qtcore/qcborstreamwriter.html
  2579. share/doc/qt5/qtcore/qcborvalue-members.html
  2580. share/doc/qt5/qtcore/qcborvalue.html
  2581. share/doc/qt5/qtcore/qchar-members.html
  2582. share/doc/qt5/qtcore/qchar-obsolete.html
  2583. share/doc/qt5/qtcore/qchar.html
  2584. share/doc/qt5/qtcore/qchildevent-members.html
  2585. share/doc/qt5/qtcore/qchildevent.html
  2586. share/doc/qt5/qtcore/qcollator-members.html
  2587. share/doc/qt5/qtcore/qcollator.html
  2588. share/doc/qt5/qtcore/qcollatorsortkey-members.html
  2589. share/doc/qt5/qtcore/qcollatorsortkey.html
  2590. share/doc/qt5/qtcore/qcommandlineoption-members.html
  2591. share/doc/qt5/qtcore/qcommandlineoption-obsolete.html
  2592. share/doc/qt5/qtcore/qcommandlineoption.html
  2593. share/doc/qt5/qtcore/qcommandlineparser-members.html
  2594. share/doc/qt5/qtcore/qcommandlineparser.html
  2595. share/doc/qt5/qtcore/qcontiguouscache-members.html
  2596. share/doc/qt5/qtcore/qcontiguouscache.html
  2597. share/doc/qt5/qtcore/qcoreapplication-members.html
  2598. share/doc/qt5/qtcore/qcoreapplication-obsolete.html
  2599. share/doc/qt5/qtcore/qcoreapplication.html
  2600. share/doc/qt5/qtcore/qcryptographichash-members.html
  2601. share/doc/qt5/qtcore/qcryptographichash.html
  2602. share/doc/qt5/qtcore/qdatastream-members.html
  2603. share/doc/qt5/qtcore/qdatastream-obsolete.html
  2604. share/doc/qt5/qtcore/qdatastream.html
  2605. share/doc/qt5/qtcore/qdate-members.html
  2606. share/doc/qt5/qtcore/qdate-obsolete.html
  2607. share/doc/qt5/qtcore/qdate.html
  2608. share/doc/qt5/qtcore/qdatetime-members.html
  2609. share/doc/qt5/qtcore/qdatetime-obsolete.html
  2610. share/doc/qt5/qtcore/qdatetime.html
  2611. share/doc/qt5/qtcore/qdeadlinetimer-members.html
  2612. share/doc/qt5/qtcore/qdeadlinetimer.html
  2613. share/doc/qt5/qtcore/qdebug-members.html
  2614. share/doc/qt5/qtcore/qdebug.html
  2615. share/doc/qt5/qtcore/qdebugstatesaver-members.html
  2616. share/doc/qt5/qtcore/qdebugstatesaver.html
  2617. share/doc/qt5/qtcore/qdir-members.html
  2618. share/doc/qt5/qtcore/qdir-obsolete.html
  2619. share/doc/qt5/qtcore/qdir.html
  2620. share/doc/qt5/qtcore/qdiriterator-members.html
  2621. share/doc/qt5/qtcore/qdiriterator.html
  2622. share/doc/qt5/qtcore/qdynamicpropertychangeevent-members.html
  2623. share/doc/qt5/qtcore/qdynamicpropertychangeevent.html
  2624. share/doc/qt5/qtcore/qeasingcurve-members.html
  2625. share/doc/qt5/qtcore/qeasingcurve-obsolete.html
  2626. share/doc/qt5/qtcore/qeasingcurve.html
  2627. share/doc/qt5/qtcore/qelapsedtimer-members.html
  2628. share/doc/qt5/qtcore/qelapsedtimer.html
  2629. share/doc/qt5/qtcore/qenablesharedfromthis-members.html
  2630. share/doc/qt5/qtcore/qenablesharedfromthis.html
  2631. share/doc/qt5/qtcore/qevent-members.html
  2632. share/doc/qt5/qtcore/qevent.html
  2633. share/doc/qt5/qtcore/qeventloop-members.html
  2634. share/doc/qt5/qtcore/qeventloop-obsolete.html
  2635. share/doc/qt5/qtcore/qeventloop.html
  2636. share/doc/qt5/qtcore/qeventlooplocker-members.html
  2637. share/doc/qt5/qtcore/qeventlooplocker.html
  2638. share/doc/qt5/qtcore/qeventtransition-members.html
  2639. share/doc/qt5/qtcore/qeventtransition-obsolete.html
  2640. share/doc/qt5/qtcore/qeventtransition.html
  2641. share/doc/qt5/qtcore/qexception-members.html
  2642. share/doc/qt5/qtcore/qexception.html
  2643. share/doc/qt5/qtcore/qexplicitlyshareddatapointer-members.html
  2644. share/doc/qt5/qtcore/qexplicitlyshareddatapointer.html
  2645. share/doc/qt5/qtcore/qfile-members.html
  2646. share/doc/qt5/qtcore/qfile-obsolete.html
  2647. share/doc/qt5/qtcore/qfile.html
  2648. share/doc/qt5/qtcore/qfiledevice-members.html
  2649. share/doc/qt5/qtcore/qfiledevice-obsolete.html
  2650. share/doc/qt5/qtcore/qfiledevice.html
  2651. share/doc/qt5/qtcore/qfileinfo-members.html
  2652. share/doc/qt5/qtcore/qfileinfo-obsolete.html
  2653. share/doc/qt5/qtcore/qfileinfo.html
  2654. share/doc/qt5/qtcore/qfileselector-members.html
  2655. share/doc/qt5/qtcore/qfileselector-obsolete.html
  2656. share/doc/qt5/qtcore/qfileselector.html
  2657. share/doc/qt5/qtcore/qfilesystemwatcher-members.html
  2658. share/doc/qt5/qtcore/qfilesystemwatcher-obsolete.html
  2659. share/doc/qt5/qtcore/qfilesystemwatcher.html
  2660. share/doc/qt5/qtcore/qfinalstate-members.html
  2661. share/doc/qt5/qtcore/qfinalstate-obsolete.html
  2662. share/doc/qt5/qtcore/qfinalstate.html
  2663. share/doc/qt5/qtcore/qflag-members.html
  2664. share/doc/qt5/qtcore/qflag.html
  2665. share/doc/qt5/qtcore/qflags-members.html
  2666. share/doc/qt5/qtcore/qflags.html
  2667. share/doc/qt5/qtcore/qfloat16.html
  2668. share/doc/qt5/qtcore/qfuture-const-iterator-members.html
  2669. share/doc/qt5/qtcore/qfuture-const-iterator.html
  2670. share/doc/qt5/qtcore/qfuture-members.html
  2671. share/doc/qt5/qtcore/qfuture.html
  2672. share/doc/qt5/qtcore/qfutureiterator-members.html
  2673. share/doc/qt5/qtcore/qfutureiterator.html
  2674. share/doc/qt5/qtcore/qfuturesynchronizer-members.html
  2675. share/doc/qt5/qtcore/qfuturesynchronizer.html
  2676. share/doc/qt5/qtcore/qfuturewatcher-members.html
  2677. share/doc/qt5/qtcore/qfuturewatcher-obsolete.html
  2678. share/doc/qt5/qtcore/qfuturewatcher.html
  2679. share/doc/qt5/qtcore/qgenericargument-members.html
  2680. share/doc/qt5/qtcore/qgenericargument.html
  2681. share/doc/qt5/qtcore/qgenericreturnargument-members.html
  2682. share/doc/qt5/qtcore/qgenericreturnargument.html
  2683. share/doc/qt5/qtcore/qglobalstatic-members.html
  2684. share/doc/qt5/qtcore/qglobalstatic-obsolete.html
  2685. share/doc/qt5/qtcore/qglobalstatic.html
  2686. share/doc/qt5/qtcore/qhash-const-iterator-members.html
  2687. share/doc/qt5/qtcore/qhash-const-iterator.html
  2688. share/doc/qt5/qtcore/qhash-iterator-members.html
  2689. share/doc/qt5/qtcore/qhash-iterator.html
  2690. share/doc/qt5/qtcore/qhash-key-iterator-members.html
  2691. share/doc/qt5/qtcore/qhash-key-iterator.html
  2692. share/doc/qt5/qtcore/qhash-members.html
  2693. share/doc/qt5/qtcore/qhash.html
  2694. share/doc/qt5/qtcore/qhashiterator-members.html
  2695. share/doc/qt5/qtcore/qhashiterator.html
  2696. share/doc/qt5/qtcore/qhistorystate-members.html
  2697. share/doc/qt5/qtcore/qhistorystate-obsolete.html
  2698. share/doc/qt5/qtcore/qhistorystate.html
  2699. share/doc/qt5/qtcore/qidentityproxymodel-members.html
  2700. share/doc/qt5/qtcore/qidentityproxymodel-obsolete.html
  2701. share/doc/qt5/qtcore/qidentityproxymodel.html
  2702. share/doc/qt5/qtcore/qiodevice-members.html
  2703. share/doc/qt5/qtcore/qiodevice-obsolete.html
  2704. share/doc/qt5/qtcore/qiodevice.html
  2705. share/doc/qt5/qtcore/qitemselection-members.html
  2706. share/doc/qt5/qtcore/qitemselection.html
  2707. share/doc/qt5/qtcore/qitemselectionmodel-members.html
  2708. share/doc/qt5/qtcore/qitemselectionmodel-obsolete.html
  2709. share/doc/qt5/qtcore/qitemselectionmodel.html
  2710. share/doc/qt5/qtcore/qitemselectionrange-members.html
  2711. share/doc/qt5/qtcore/qitemselectionrange-obsolete.html
  2712. share/doc/qt5/qtcore/qitemselectionrange.html
  2713. share/doc/qt5/qtcore/qjsonarray-const-iterator-members.html
  2714. share/doc/qt5/qtcore/qjsonarray-const-iterator.html
  2715. share/doc/qt5/qtcore/qjsonarray-iterator-members.html
  2716. share/doc/qt5/qtcore/qjsonarray-iterator.html
  2717. share/doc/qt5/qtcore/qjsonarray-members.html
  2718. share/doc/qt5/qtcore/qjsonarray.html
  2719. share/doc/qt5/qtcore/qjsondocument-members.html
  2720. share/doc/qt5/qtcore/qjsondocument.html
  2721. share/doc/qt5/qtcore/qjsonobject-const-iterator-members.html
  2722. share/doc/qt5/qtcore/qjsonobject-const-iterator.html
  2723. share/doc/qt5/qtcore/qjsonobject-iterator-members.html
  2724. share/doc/qt5/qtcore/qjsonobject-iterator.html
  2725. share/doc/qt5/qtcore/qjsonobject-members.html
  2726. share/doc/qt5/qtcore/qjsonobject.html
  2727. share/doc/qt5/qtcore/qjsonparseerror-members.html
  2728. share/doc/qt5/qtcore/qjsonparseerror.html
  2729. share/doc/qt5/qtcore/qjsonvalue-members.html
  2730. share/doc/qt5/qtcore/qjsonvalue.html
  2731. share/doc/qt5/qtcore/qkeyvalueiterator-members.html
  2732. share/doc/qt5/qtcore/qkeyvalueiterator.html
  2733. share/doc/qt5/qtcore/qlatin1char-members.html
  2734. share/doc/qt5/qtcore/qlatin1char.html
  2735. share/doc/qt5/qtcore/qlatin1string-members.html
  2736. share/doc/qt5/qtcore/qlatin1string.html
  2737. share/doc/qt5/qtcore/qleinteger-members.html
  2738. share/doc/qt5/qtcore/qleinteger.html
  2739. share/doc/qt5/qtcore/qlibrary-members.html
  2740. share/doc/qt5/qtcore/qlibrary-obsolete.html
  2741. share/doc/qt5/qtcore/qlibrary.html
  2742. share/doc/qt5/qtcore/qlibraryinfo-members.html
  2743. share/doc/qt5/qtcore/qlibraryinfo-obsolete.html
  2744. share/doc/qt5/qtcore/qlibraryinfo.html
  2745. share/doc/qt5/qtcore/qline-members.html
  2746. share/doc/qt5/qtcore/qline.html
  2747. share/doc/qt5/qtcore/qlinef-members.html
  2748. share/doc/qt5/qtcore/qlinef-obsolete.html
  2749. share/doc/qt5/qtcore/qlinef.html
  2750. share/doc/qt5/qtcore/qlinkedlist-const-iterator-members.html
  2751. share/doc/qt5/qtcore/qlinkedlist-const-iterator.html
  2752. share/doc/qt5/qtcore/qlinkedlist-iterator-members.html
  2753. share/doc/qt5/qtcore/qlinkedlist-iterator.html
  2754. share/doc/qt5/qtcore/qlinkedlist-members.html
  2755. share/doc/qt5/qtcore/qlinkedlist.html
  2756. share/doc/qt5/qtcore/qlinkedlistiterator-members.html
  2757. share/doc/qt5/qtcore/qlinkedlistiterator.html
  2758. share/doc/qt5/qtcore/qlist-const-iterator-members.html
  2759. share/doc/qt5/qtcore/qlist-const-iterator.html
  2760. share/doc/qt5/qtcore/qlist-iterator-members.html
  2761. share/doc/qt5/qtcore/qlist-iterator.html
  2762. share/doc/qt5/qtcore/qlist-members.html
  2763. share/doc/qt5/qtcore/qlist-memorylayout.html
  2764. share/doc/qt5/qtcore/qlist.html
  2765. share/doc/qt5/qtcore/qlistiterator-members.html
  2766. share/doc/qt5/qtcore/qlistiterator.html
  2767. share/doc/qt5/qtcore/qlocale-members.html
  2768. share/doc/qt5/qtcore/qlocale-obsolete.html
  2769. share/doc/qt5/qtcore/qlocale.html
  2770. share/doc/qt5/qtcore/qlockfile-members.html
  2771. share/doc/qt5/qtcore/qlockfile.html
  2772. share/doc/qt5/qtcore/qloggingcategory-members.html
  2773. share/doc/qt5/qtcore/qloggingcategory.html
  2774. share/doc/qt5/qtcore/qmap-const-iterator-members.html
  2775. share/doc/qt5/qtcore/qmap-const-iterator.html
  2776. share/doc/qt5/qtcore/qmap-iterator-members.html
  2777. share/doc/qt5/qtcore/qmap-iterator.html
  2778. share/doc/qt5/qtcore/qmap-key-iterator-members.html
  2779. share/doc/qt5/qtcore/qmap-key-iterator.html
  2780. share/doc/qt5/qtcore/qmap-members.html
  2781. share/doc/qt5/qtcore/qmap.html
  2782. share/doc/qt5/qtcore/qmapiterator-members.html
  2783. share/doc/qt5/qtcore/qmapiterator.html
  2784. share/doc/qt5/qtcore/qmargins-members.html
  2785. share/doc/qt5/qtcore/qmargins.html
  2786. share/doc/qt5/qtcore/qmarginsf-members.html
  2787. share/doc/qt5/qtcore/qmarginsf.html
  2788. share/doc/qt5/qtcore/qmessageauthenticationcode-members.html
  2789. share/doc/qt5/qtcore/qmessageauthenticationcode.html
  2790. share/doc/qt5/qtcore/qmessagelogcontext-members.html
  2791. share/doc/qt5/qtcore/qmessagelogcontext.html
  2792. share/doc/qt5/qtcore/qmessagelogger-members.html
  2793. share/doc/qt5/qtcore/qmessagelogger.html
  2794. share/doc/qt5/qtcore/qmetaclassinfo-members.html
  2795. share/doc/qt5/qtcore/qmetaclassinfo.html
  2796. share/doc/qt5/qtcore/qmetaenum-members.html
  2797. share/doc/qt5/qtcore/qmetaenum.html
  2798. share/doc/qt5/qtcore/qmetamethod-members.html
  2799. share/doc/qt5/qtcore/qmetamethod.html
  2800. share/doc/qt5/qtcore/qmetaobject-connection-members.html
  2801. share/doc/qt5/qtcore/qmetaobject-connection.html
  2802. share/doc/qt5/qtcore/qmetaobject-members.html
  2803. share/doc/qt5/qtcore/qmetaobject.html
  2804. share/doc/qt5/qtcore/qmetaproperty-members.html
  2805. share/doc/qt5/qtcore/qmetaproperty-obsolete.html
  2806. share/doc/qt5/qtcore/qmetaproperty.html
  2807. share/doc/qt5/qtcore/qmetatype-members.html
  2808. share/doc/qt5/qtcore/qmetatype-obsolete.html
  2809. share/doc/qt5/qtcore/qmetatype.html
  2810. share/doc/qt5/qtcore/qmimedata-members.html
  2811. share/doc/qt5/qtcore/qmimedata-obsolete.html
  2812. share/doc/qt5/qtcore/qmimedata.html
  2813. share/doc/qt5/qtcore/qmimedatabase-members.html
  2814. share/doc/qt5/qtcore/qmimedatabase.html
  2815. share/doc/qt5/qtcore/qmimetype-members.html
  2816. share/doc/qt5/qtcore/qmimetype.html
  2817. share/doc/qt5/qtcore/qmodelindex-members.html
  2818. share/doc/qt5/qtcore/qmodelindex-obsolete.html
  2819. share/doc/qt5/qtcore/qmodelindex.html
  2820. share/doc/qt5/qtcore/qmultihash-members.html
  2821. share/doc/qt5/qtcore/qmultihash.html
  2822. share/doc/qt5/qtcore/qmultimap-members.html
  2823. share/doc/qt5/qtcore/qmultimap.html
  2824. share/doc/qt5/qtcore/qmutablehashiterator-members.html
  2825. share/doc/qt5/qtcore/qmutablehashiterator.html
  2826. share/doc/qt5/qtcore/qmutablelinkedlistiterator-members.html
  2827. share/doc/qt5/qtcore/qmutablelinkedlistiterator.html
  2828. share/doc/qt5/qtcore/qmutablelistiterator-members.html
  2829. share/doc/qt5/qtcore/qmutablelistiterator.html
  2830. share/doc/qt5/qtcore/qmutablemapiterator-members.html
  2831. share/doc/qt5/qtcore/qmutablemapiterator.html
  2832. share/doc/qt5/qtcore/qmutablesetiterator-members.html
  2833. share/doc/qt5/qtcore/qmutablesetiterator.html
  2834. share/doc/qt5/qtcore/qmutablevectoriterator-members.html
  2835. share/doc/qt5/qtcore/qmutablevectoriterator.html
  2836. share/doc/qt5/qtcore/qmutex-members.html
  2837. share/doc/qt5/qtcore/qmutex.html
  2838. share/doc/qt5/qtcore/qmutexlocker-members.html
  2839. share/doc/qt5/qtcore/qmutexlocker.html
  2840. share/doc/qt5/qtcore/qobject-members.html
  2841. share/doc/qt5/qtcore/qobject-obsolete.html
  2842. share/doc/qt5/qtcore/qobject.html
  2843. share/doc/qt5/qtcore/qobjectcleanuphandler-members.html
  2844. share/doc/qt5/qtcore/qobjectcleanuphandler-obsolete.html
  2845. share/doc/qt5/qtcore/qobjectcleanuphandler.html
  2846. share/doc/qt5/qtcore/qoperatingsystemversion-members.html
  2847. share/doc/qt5/qtcore/qoperatingsystemversion.html
  2848. share/doc/qt5/qtcore/qpair-members.html
  2849. share/doc/qt5/qtcore/qpair.html
  2850. share/doc/qt5/qtcore/qparallelanimationgroup-members.html
  2851. share/doc/qt5/qtcore/qparallelanimationgroup-obsolete.html
  2852. share/doc/qt5/qtcore/qparallelanimationgroup.html
  2853. share/doc/qt5/qtcore/qpauseanimation-members.html
  2854. share/doc/qt5/qtcore/qpauseanimation-obsolete.html
  2855. share/doc/qt5/qtcore/qpauseanimation.html
  2856. share/doc/qt5/qtcore/qpersistentmodelindex-members.html
  2857. share/doc/qt5/qtcore/qpersistentmodelindex-obsolete.html
  2858. share/doc/qt5/qtcore/qpersistentmodelindex.html
  2859. share/doc/qt5/qtcore/qpluginloader-members.html
  2860. share/doc/qt5/qtcore/qpluginloader-obsolete.html
  2861. share/doc/qt5/qtcore/qpluginloader.html
  2862. share/doc/qt5/qtcore/qpoint-members.html
  2863. share/doc/qt5/qtcore/qpoint.html
  2864. share/doc/qt5/qtcore/qpointer-members.html
  2865. share/doc/qt5/qtcore/qpointer.html
  2866. share/doc/qt5/qtcore/qpointf-members.html
  2867. share/doc/qt5/qtcore/qpointf.html
  2868. share/doc/qt5/qtcore/qprocess-createprocessarguments-members.html
  2869. share/doc/qt5/qtcore/qprocess-createprocessarguments.html
  2870. share/doc/qt5/qtcore/qprocess-members.html
  2871. share/doc/qt5/qtcore/qprocess-obsolete.html
  2872. share/doc/qt5/qtcore/qprocess.html
  2873. share/doc/qt5/qtcore/qprocessenvironment-members.html
  2874. share/doc/qt5/qtcore/qprocessenvironment.html
  2875. share/doc/qt5/qtcore/qpropertyanimation-members.html
  2876. share/doc/qt5/qtcore/qpropertyanimation-obsolete.html
  2877. share/doc/qt5/qtcore/qpropertyanimation.html
  2878. share/doc/qt5/qtcore/qqueue-members.html
  2879. share/doc/qt5/qtcore/qqueue.html
  2880. share/doc/qt5/qtcore/qrandomgenerator-members.html
  2881. share/doc/qt5/qtcore/qrandomgenerator-storage-members.html
  2882. share/doc/qt5/qtcore/qrandomgenerator-storage.html
  2883. share/doc/qt5/qtcore/qrandomgenerator.html
  2884. share/doc/qt5/qtcore/qrandomgenerator64-members.html
  2885. share/doc/qt5/qtcore/qrandomgenerator64.html
  2886. share/doc/qt5/qtcore/qreadlocker-members.html
  2887. share/doc/qt5/qtcore/qreadlocker.html
  2888. share/doc/qt5/qtcore/qreadwritelock-members.html
  2889. share/doc/qt5/qtcore/qreadwritelock.html
  2890. share/doc/qt5/qtcore/qrect-members.html
  2891. share/doc/qt5/qtcore/qrect-obsolete.html
  2892. share/doc/qt5/qtcore/qrect.html
  2893. share/doc/qt5/qtcore/qrectf-members.html
  2894. share/doc/qt5/qtcore/qrectf-obsolete.html
  2895. share/doc/qt5/qtcore/qrectf.html
  2896. share/doc/qt5/qtcore/qregexp-members.html
  2897. share/doc/qt5/qtcore/qregexp.html
  2898. share/doc/qt5/qtcore/qregularexpression-members.html
  2899. share/doc/qt5/qtcore/qregularexpression.html
  2900. share/doc/qt5/qtcore/qregularexpressionmatch-members.html
  2901. share/doc/qt5/qtcore/qregularexpressionmatch.html
  2902. share/doc/qt5/qtcore/qregularexpressionmatchiterator-members.html
  2903. share/doc/qt5/qtcore/qregularexpressionmatchiterator.html
  2904. share/doc/qt5/qtcore/qresource-members.html
  2905. share/doc/qt5/qtcore/qresource-obsolete.html
  2906. share/doc/qt5/qtcore/qresource.html
  2907. share/doc/qt5/qtcore/qrunnable-members.html
  2908. share/doc/qt5/qtcore/qrunnable.html
  2909. share/doc/qt5/qtcore/qsavefile-members.html
  2910. share/doc/qt5/qtcore/qsavefile-obsolete.html
  2911. share/doc/qt5/qtcore/qsavefile.html
  2912. share/doc/qt5/qtcore/qscopedarraypointer-members.html
  2913. share/doc/qt5/qtcore/qscopedarraypointer.html
  2914. share/doc/qt5/qtcore/qscopedpointer-members.html
  2915. share/doc/qt5/qtcore/qscopedpointer.html
  2916. share/doc/qt5/qtcore/qscopedvaluerollback-members.html
  2917. share/doc/qt5/qtcore/qscopedvaluerollback.html
  2918. share/doc/qt5/qtcore/qscopeguard-members.html
  2919. share/doc/qt5/qtcore/qscopeguard.html
  2920. share/doc/qt5/qtcore/qsemaphore-members.html
  2921. share/doc/qt5/qtcore/qsemaphore.html
  2922. share/doc/qt5/qtcore/qsemaphorereleaser-members.html
  2923. share/doc/qt5/qtcore/qsemaphorereleaser.html
  2924. share/doc/qt5/qtcore/qsequentialanimationgroup-members.html
  2925. share/doc/qt5/qtcore/qsequentialanimationgroup-obsolete.html
  2926. share/doc/qt5/qtcore/qsequentialanimationgroup.html
  2927. share/doc/qt5/qtcore/qsequentialiterable-const-iterator-members.html
  2928. share/doc/qt5/qtcore/qsequentialiterable-const-iterator.html
  2929. share/doc/qt5/qtcore/qsequentialiterable-members.html
  2930. share/doc/qt5/qtcore/qsequentialiterable.html
  2931. share/doc/qt5/qtcore/qset-const-iterator-members.html
  2932. share/doc/qt5/qtcore/qset-const-iterator.html
  2933. share/doc/qt5/qtcore/qset-iterator-members.html
  2934. share/doc/qt5/qtcore/qset-iterator.html
  2935. share/doc/qt5/qtcore/qset-members.html
  2936. share/doc/qt5/qtcore/qset.html
  2937. share/doc/qt5/qtcore/qsetiterator-members.html
  2938. share/doc/qt5/qtcore/qsetiterator.html
  2939. share/doc/qt5/qtcore/qsettings-members.html
  2940. share/doc/qt5/qtcore/qsettings-obsolete.html
  2941. share/doc/qt5/qtcore/qsettings.html
  2942. share/doc/qt5/qtcore/qshareddata-members.html
  2943. share/doc/qt5/qtcore/qshareddata.html
  2944. share/doc/qt5/qtcore/qshareddatapointer-members.html
  2945. share/doc/qt5/qtcore/qshareddatapointer.html
  2946. share/doc/qt5/qtcore/qsharedmemory-members.html
  2947. share/doc/qt5/qtcore/qsharedmemory-obsolete.html
  2948. share/doc/qt5/qtcore/qsharedmemory.html
  2949. share/doc/qt5/qtcore/qsharedpointer-members.html
  2950. share/doc/qt5/qtcore/qsharedpointer.html
  2951. share/doc/qt5/qtcore/qsignalblocker-members.html
  2952. share/doc/qt5/qtcore/qsignalblocker.html
  2953. share/doc/qt5/qtcore/qsignalmapper-members.html
  2954. share/doc/qt5/qtcore/qsignalmapper-obsolete.html
  2955. share/doc/qt5/qtcore/qsignalmapper.html
  2956. share/doc/qt5/qtcore/qsignaltransition-members.html
  2957. share/doc/qt5/qtcore/qsignaltransition-obsolete.html
  2958. share/doc/qt5/qtcore/qsignaltransition.html
  2959. share/doc/qt5/qtcore/qsize-members.html
  2960. share/doc/qt5/qtcore/qsize.html
  2961. share/doc/qt5/qtcore/qsizef-members.html
  2962. share/doc/qt5/qtcore/qsizef.html
  2963. share/doc/qt5/qtcore/qsocketnotifier-members.html
  2964. share/doc/qt5/qtcore/qsocketnotifier-obsolete.html
  2965. share/doc/qt5/qtcore/qsocketnotifier.html
  2966. share/doc/qt5/qtcore/qsortfilterproxymodel-members.html
  2967. share/doc/qt5/qtcore/qsortfilterproxymodel-obsolete.html
  2968. share/doc/qt5/qtcore/qsortfilterproxymodel.html
  2969. share/doc/qt5/qtcore/qstack-members.html
  2970. share/doc/qt5/qtcore/qstack.html
  2971. share/doc/qt5/qtcore/qstandardpaths-members.html
  2972. share/doc/qt5/qtcore/qstandardpaths-obsolete.html
  2973. share/doc/qt5/qtcore/qstandardpaths.html
  2974. share/doc/qt5/qtcore/qstate-members.html
  2975. share/doc/qt5/qtcore/qstate-obsolete.html
  2976. share/doc/qt5/qtcore/qstate.html
  2977. share/doc/qt5/qtcore/qstatemachine-members.html
  2978. share/doc/qt5/qtcore/qstatemachine-obsolete.html
  2979. share/doc/qt5/qtcore/qstatemachine-signalevent-members.html
  2980. share/doc/qt5/qtcore/qstatemachine-signalevent.html
  2981. share/doc/qt5/qtcore/qstatemachine-wrappedevent-members.html
  2982. share/doc/qt5/qtcore/qstatemachine-wrappedevent.html
  2983. share/doc/qt5/qtcore/qstatemachine.html
  2984. share/doc/qt5/qtcore/qstaticbytearraymatcher-members.html
  2985. share/doc/qt5/qtcore/qstaticbytearraymatcher.html
  2986. share/doc/qt5/qtcore/qstaticplugin-members.html
  2987. share/doc/qt5/qtcore/qstaticplugin.html
  2988. share/doc/qt5/qtcore/qstorageinfo-members.html
  2989. share/doc/qt5/qtcore/qstorageinfo.html
  2990. share/doc/qt5/qtcore/qstring-members.html
  2991. share/doc/qt5/qtcore/qstring-null.html
  2992. share/doc/qt5/qtcore/qstring-obsolete.html
  2993. share/doc/qt5/qtcore/qstring.html
  2994. share/doc/qt5/qtcore/qstringlist-members.html
  2995. share/doc/qt5/qtcore/qstringlist.html
  2996. share/doc/qt5/qtcore/qstringlistmodel-members.html
  2997. share/doc/qt5/qtcore/qstringlistmodel-obsolete.html
  2998. share/doc/qt5/qtcore/qstringlistmodel.html
  2999. share/doc/qt5/qtcore/qstringmatcher-members.html
  3000. share/doc/qt5/qtcore/qstringmatcher.html
  3001. share/doc/qt5/qtcore/qstringref-members.html
  3002. share/doc/qt5/qtcore/qstringref-obsolete.html
  3003. share/doc/qt5/qtcore/qstringref.html
  3004. share/doc/qt5/qtcore/qstringview-members.html
  3005. share/doc/qt5/qtcore/qstringview.html
  3006. share/doc/qt5/qtcore/qsysinfo-members.html
  3007. share/doc/qt5/qtcore/qsysinfo-obsolete.html
  3008. share/doc/qt5/qtcore/qsysinfo.html
  3009. share/doc/qt5/qtcore/qsystemsemaphore-members.html
  3010. share/doc/qt5/qtcore/qsystemsemaphore.html
  3011. share/doc/qt5/qtcore/qt-obsolete.html
  3012. share/doc/qt5/qtcore/qt.html
  3013. share/doc/qt5/qtcore/qtalgorithms-obsolete.html
  3014. share/doc/qt5/qtcore/qtalgorithms.html
  3015. share/doc/qt5/qtcore/qtcborcommon-members.html
  3016. share/doc/qt5/qtcore/qtcborcommon.html
  3017. share/doc/qt5/qtcore/qtcore-attribution-android-gradle-wrapper.html
  3018. share/doc/qt5/qtcore/qtcore-attribution-doubleconversion.html
  3019. share/doc/qt5/qtcore/qtcore-attribution-easing.html
  3020. share/doc/qt5/qtcore/qtcore-attribution-forkfd.html
  3021. share/doc/qt5/qtcore/qtcore-attribution-freebsd.html
  3022. share/doc/qt5/qtcore/qtcore-attribution-md4.html
  3023. share/doc/qt5/qtcore/qtcore-attribution-md5.html
  3024. share/doc/qt5/qtcore/qtcore-attribution-pcre2-sljit.html
  3025. share/doc/qt5/qtcore/qtcore-attribution-pcre2.html
  3026. share/doc/qt5/qtcore/qtcore-attribution-psl.html
  3027. share/doc/qt5/qtcore/qtcore-attribution-qbig5codecs.html
  3028. share/doc/qt5/qtcore/qtcore-attribution-qbkcodec.html
  3029. share/doc/qt5/qtcore/qtcore-attribution-qeucjpcodec.html
  3030. share/doc/qt5/qtcore/qtcore-attribution-qeuckrcodec.html
  3031. share/doc/qt5/qtcore/qtcore-attribution-qeventdispatcher-cf.html
  3032. share/doc/qt5/qtcore/qtcore-attribution-qjiscodec.html
  3033. share/doc/qt5/qtcore/qtcore-attribution-qsjiscodec.html
  3034. share/doc/qt5/qtcore/qtcore-attribution-qtsciicodec.html
  3035. share/doc/qt5/qtcore/qtcore-attribution-rfc6234.html
  3036. share/doc/qt5/qtcore/qtcore-attribution-sha1.html
  3037. share/doc/qt5/qtcore/qtcore-attribution-sha3-endian.html
  3038. share/doc/qt5/qtcore/qtcore-attribution-sha3-keccak.html
  3039. share/doc/qt5/qtcore/qtcore-attribution-tinycbor.html
  3040. share/doc/qt5/qtcore/qtcore-attribution-unicode-character-database.html
  3041. share/doc/qt5/qtcore/qtcore-attribution-unicode-cldr.html
  3042. share/doc/qt5/qtcore/qtcore-attribution-zlib.html
  3043. share/doc/qt5/qtcore/qtcore-index.html
  3044. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-cpp.html
  3045. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-client-h.html
  3046. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-example.html
  3047. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-localfortuneclient-pro.html
  3048. share/doc/qt5/qtcore/qtcore-ipc-localfortuneclient-main-cpp.html
  3049. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-example.html
  3050. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-localfortuneserver-pro.html
  3051. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-main-cpp.html
  3052. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-cpp.html
  3053. share/doc/qt5/qtcore/qtcore-ipc-localfortuneserver-server-h.html
  3054. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-cpp.html
  3055. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-h.html
  3056. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-dialog-ui.html
  3057. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-example.html
  3058. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-main-cpp.html
  3059. share/doc/qt5/qtcore/qtcore-ipc-sharedmemory-sharedmemory-pro.html
  3060. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
  3061. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-main-cpp.html
  3062. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-cpp.html
  3063. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mainwindow-h.html
  3064. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypebrowser-pro.html
  3065. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-cpp.html
  3066. share/doc/qt5/qtcore/qtcore-mimetypes-mimetypebrowser-mimetypemodel-h.html
  3067. share/doc/qt5/qtcore/qtcore-module.html
  3068. share/doc/qt5/qtcore/qtcore-serialization-savegame-character-cpp.html
  3069. share/doc/qt5/qtcore/qtcore-serialization-savegame-character-h.html
  3070. share/doc/qt5/qtcore/qtcore-serialization-savegame-example.html
  3071. share/doc/qt5/qtcore/qtcore-serialization-savegame-game-cpp.html
  3072. share/doc/qt5/qtcore/qtcore-serialization-savegame-game-h.html
  3073. share/doc/qt5/qtcore/qtcore-serialization-savegame-level-cpp.html
  3074. share/doc/qt5/qtcore/qtcore-serialization-savegame-level-h.html
  3075. share/doc/qt5/qtcore/qtcore-serialization-savegame-main-cpp.html
  3076. share/doc/qt5/qtcore/qtcore-serialization-savegame-savegame-pro.html
  3077. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-example.html
  3078. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-main-cpp.html
  3079. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrot-pro.html
  3080. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-cpp.html
  3081. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-mandelbrotwidget-h.html
  3082. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-cpp.html
  3083. share/doc/qt5/qtcore/qtcore-threads-mandelbrot-renderthread-h.html
  3084. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-cpp.html
  3085. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-block-h.html
  3086. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-example.html
  3087. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-main-cpp.html
  3088. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-queuedcustomtype-pro.html
  3089. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-cpp.html
  3090. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-renderthread-h.html
  3091. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-cpp.html
  3092. share/doc/qt5/qtcore/qtcore-threads-queuedcustomtype-window-h.html
  3093. share/doc/qt5/qtcore/qtcore-threads-semaphores-example.html
  3094. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-cpp.html
  3095. share/doc/qt5/qtcore/qtcore-threads-semaphores-semaphores-pro.html
  3096. share/doc/qt5/qtcore/qtcore-threads-waitconditions-example.html
  3097. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-cpp.html
  3098. share/doc/qt5/qtcore/qtcore-threads-waitconditions-waitconditions-pro.html
  3099. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-contiguouscache-pro.html
  3100. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-example.html
  3101. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-main-cpp.html
  3102. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-cpp.html
  3103. share/doc/qt5/qtcore/qtcore-tools-contiguouscache-randomlistmodel-h.html
  3104. share/doc/qt5/qtcore/qtcore-tools-customtype-customtype-pro.html
  3105. share/doc/qt5/qtcore/qtcore-tools-customtype-example.html
  3106. share/doc/qt5/qtcore/qtcore-tools-customtype-main-cpp.html
  3107. share/doc/qt5/qtcore/qtcore-tools-customtype-message-cpp.html
  3108. share/doc/qt5/qtcore/qtcore-tools-customtype-message-h.html
  3109. share/doc/qt5/qtcore/qtcore.index
  3110. share/doc/qt5/qtcore/qtcore.qhp
  3111. share/doc/qt5/qtcore/qtcore.qhp.sha1
  3112. share/doc/qt5/qtcore/qtcore.tags
  3113. share/doc/qt5/qtcore/qtemporarydir-members.html
  3114. share/doc/qt5/qtcore/qtemporarydir.html
  3115. share/doc/qt5/qtcore/qtemporaryfile-members.html
  3116. share/doc/qt5/qtcore/qtemporaryfile-obsolete.html
  3117. share/doc/qt5/qtcore/qtemporaryfile.html
  3118. share/doc/qt5/qtcore/qtendian.html
  3119. share/doc/qt5/qtcore/qtextboundaryfinder-members.html
  3120. share/doc/qt5/qtcore/qtextboundaryfinder.html
  3121. share/doc/qt5/qtcore/qtextcodec-converterstate-members.html
  3122. share/doc/qt5/qtcore/qtextcodec-converterstate.html
  3123. share/doc/qt5/qtcore/qtextcodec-members.html
  3124. share/doc/qt5/qtcore/qtextcodec-obsolete.html
  3125. share/doc/qt5/qtcore/qtextcodec.html
  3126. share/doc/qt5/qtcore/qtextdecoder-members.html
  3127. share/doc/qt5/qtcore/qtextdecoder.html
  3128. share/doc/qt5/qtcore/qtextencoder-members.html
  3129. share/doc/qt5/qtcore/qtextencoder.html
  3130. share/doc/qt5/qtcore/qtextstream-members.html
  3131. share/doc/qt5/qtcore/qtextstream.html
  3132. share/doc/qt5/qtcore/qtglobal-obsolete.html
  3133. share/doc/qt5/qtcore/qtglobal.html
  3134. share/doc/qt5/qtcore/qthread-members.html
  3135. share/doc/qt5/qtcore/qthread-obsolete.html
  3136. share/doc/qt5/qtcore/qthread.html
  3137. share/doc/qt5/qtcore/qthreadpool-members.html
  3138. share/doc/qt5/qtcore/qthreadpool-obsolete.html
  3139. share/doc/qt5/qtcore/qthreadpool.html
  3140. share/doc/qt5/qtcore/qthreadstorage-members.html
  3141. share/doc/qt5/qtcore/qthreadstorage.html
  3142. share/doc/qt5/qtcore/qtime-members.html
  3143. share/doc/qt5/qtcore/qtime.html
  3144. share/doc/qt5/qtcore/qtimeline-members.html
  3145. share/doc/qt5/qtcore/qtimeline-obsolete.html
  3146. share/doc/qt5/qtcore/qtimeline.html
  3147. share/doc/qt5/qtcore/qtimer-members.html
  3148. share/doc/qt5/qtcore/qtimer-obsolete.html
  3149. share/doc/qt5/qtcore/qtimer.html
  3150. share/doc/qt5/qtcore/qtimerevent-members.html
  3151. share/doc/qt5/qtcore/qtimerevent.html
  3152. share/doc/qt5/qtcore/qtimezone-members.html
  3153. share/doc/qt5/qtcore/qtimezone-offsetdata-members.html
  3154. share/doc/qt5/qtcore/qtimezone-offsetdata.html
  3155. share/doc/qt5/qtcore/qtimezone.html
  3156. share/doc/qt5/qtcore/qtmath.html
  3157. share/doc/qt5/qtcore/qtplugin.html
  3158. share/doc/qt5/qtcore/qtranslator-members.html
  3159. share/doc/qt5/qtcore/qtranslator-obsolete.html
  3160. share/doc/qt5/qtcore/qtranslator.html
  3161. share/doc/qt5/qtcore/qunhandledexception-members.html
  3162. share/doc/qt5/qtcore/qunhandledexception.html
  3163. share/doc/qt5/qtcore/qurl-members.html
  3164. share/doc/qt5/qtcore/qurl-obsolete.html
  3165. share/doc/qt5/qtcore/qurl.html
  3166. share/doc/qt5/qtcore/qurlquery-members.html
  3167. share/doc/qt5/qtcore/qurlquery.html
  3168. share/doc/qt5/qtcore/quuid-members.html
  3169. share/doc/qt5/qtcore/quuid.html
  3170. share/doc/qt5/qtcore/qvariant-handler-members.html
  3171. share/doc/qt5/qtcore/qvariant-handler.html
  3172. share/doc/qt5/qtcore/qvariant-members.html
  3173. share/doc/qt5/qtcore/qvariant-obsolete.html
  3174. share/doc/qt5/qtcore/qvariant-private-data-members.html
  3175. share/doc/qt5/qtcore/qvariant-private-data.html
  3176. share/doc/qt5/qtcore/qvariant-private-members.html
  3177. share/doc/qt5/qtcore/qvariant-private.html
  3178. share/doc/qt5/qtcore/qvariant-privateshared-members.html
  3179. share/doc/qt5/qtcore/qvariant-privateshared.html
  3180. share/doc/qt5/qtcore/qvariant.html
  3181. share/doc/qt5/qtcore/qvariantanimation-members.html
  3182. share/doc/qt5/qtcore/qvariantanimation-obsolete.html
  3183. share/doc/qt5/qtcore/qvariantanimation.html
  3184. share/doc/qt5/qtcore/qvarlengtharray-members.html
  3185. share/doc/qt5/qtcore/qvarlengtharray.html
  3186. share/doc/qt5/qtcore/qvector-members.html
  3187. share/doc/qt5/qtcore/qvector.html
  3188. share/doc/qt5/qtcore/qvectoriterator-members.html
  3189. share/doc/qt5/qtcore/qvectoriterator.html
  3190. share/doc/qt5/qtcore/qversionnumber-members.html
  3191. share/doc/qt5/qtcore/qversionnumber.html
  3192. share/doc/qt5/qtcore/qwaitcondition-members.html
  3193. share/doc/qt5/qtcore/qwaitcondition.html
  3194. share/doc/qt5/qtcore/qweakpointer-members.html
  3195. share/doc/qt5/qtcore/qweakpointer-obsolete.html
  3196. share/doc/qt5/qtcore/qweakpointer.html
  3197. share/doc/qt5/qtcore/qwineventnotifier-members.html
  3198. share/doc/qt5/qtcore/qwineventnotifier-obsolete.html
  3199. share/doc/qt5/qtcore/qwineventnotifier.html
  3200. share/doc/qt5/qtcore/qwritelocker-members.html
  3201. share/doc/qt5/qtcore/qwritelocker.html
  3202. share/doc/qt5/qtcore/qxmlstreamattribute-members.html
  3203. share/doc/qt5/qtcore/qxmlstreamattribute.html
  3204. share/doc/qt5/qtcore/qxmlstreamattributes-members.html
  3205. share/doc/qt5/qtcore/qxmlstreamattributes.html
  3206. share/doc/qt5/qtcore/qxmlstreamentitydeclaration-members.html
  3207. share/doc/qt5/qtcore/qxmlstreamentitydeclaration.html
  3208. share/doc/qt5/qtcore/qxmlstreamentityresolver-members.html
  3209. share/doc/qt5/qtcore/qxmlstreamentityresolver.html
  3210. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration-members.html
  3211. share/doc/qt5/qtcore/qxmlstreamnamespacedeclaration.html
  3212. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration-members.html
  3213. share/doc/qt5/qtcore/qxmlstreamnotationdeclaration.html
  3214. share/doc/qt5/qtcore/qxmlstreamreader-members.html
  3215. share/doc/qt5/qtcore/qxmlstreamreader.html
  3216. share/doc/qt5/qtcore/qxmlstreamwriter-members.html
  3217. share/doc/qt5/qtcore/qxmlstreamwriter.html
  3218. share/doc/qt5/qtcore/resources.html
  3219. share/doc/qt5/qtcore/shared.html
  3220. share/doc/qt5/qtcore/signalsandslots.html
  3221. share/doc/qt5/qtcore/statemachine-api.html
  3222. share/doc/qt5/qtcore/statemachine.html
  3223. share/doc/qt5/qtcore/style/offline-simple.css
  3224. share/doc/qt5/qtcore/style/offline.css
  3225. share/doc/qt5/qtcore/timers.html
  3226. share/doc/qt5/qtdbus.qch
  3227. share/doc/qt5/qtdbus/examples-dbus.html
  3228. share/doc/qt5/qtdbus/examples-manifest.xml
  3229. share/doc/qt5/qtdbus/images/arrow_bc.png
  3230. share/doc/qt5/qtdbus/images/bgrContent.png
  3231. share/doc/qt5/qtdbus/images/btn_next.png
  3232. share/doc/qt5/qtdbus/images/btn_prev.png
  3233. share/doc/qt5/qtdbus/images/bullet_dn.png
  3234. share/doc/qt5/qtdbus/images/bullet_sq.png
  3235. share/doc/qt5/qtdbus/images/dbus-chat-example.png
  3236. share/doc/qt5/qtdbus/images/home.png
  3237. share/doc/qt5/qtdbus/images/ico_note.png
  3238. share/doc/qt5/qtdbus/images/ico_note_attention.png
  3239. share/doc/qt5/qtdbus/images/ico_out.png
  3240. share/doc/qt5/qtdbus/images/logo.png
  3241. share/doc/qt5/qtdbus/images/qurl-ftppath.png
  3242. share/doc/qt5/qtdbus/images/remotecontrolledcar-car-example.png
  3243. share/doc/qt5/qtdbus/qdbus.html
  3244. share/doc/qt5/qtdbus/qdbusabstractadaptor-members.html
  3245. share/doc/qt5/qtdbus/qdbusabstractadaptor-obsolete.html
  3246. share/doc/qt5/qtdbus/qdbusabstractadaptor.html
  3247. share/doc/qt5/qtdbus/qdbusabstractinterface-members.html
  3248. share/doc/qt5/qtdbus/qdbusabstractinterface-obsolete.html
  3249. share/doc/qt5/qtdbus/qdbusabstractinterface.html
  3250. share/doc/qt5/qtdbus/qdbusargument-members.html
  3251. share/doc/qt5/qtdbus/qdbusargument.html
  3252. share/doc/qt5/qtdbus/qdbusconnection-members.html
  3253. share/doc/qt5/qtdbus/qdbusconnection-obsolete.html
  3254. share/doc/qt5/qtdbus/qdbusconnection.html
  3255. share/doc/qt5/qtdbus/qdbusconnectioninterface-members.html
  3256. share/doc/qt5/qtdbus/qdbusconnectioninterface-obsolete.html
  3257. share/doc/qt5/qtdbus/qdbusconnectioninterface.html
  3258. share/doc/qt5/qtdbus/qdbuscontext-members.html
  3259. share/doc/qt5/qtdbus/qdbuscontext.html
  3260. share/doc/qt5/qtdbus/qdbusdeclaringsignals.html
  3261. share/doc/qt5/qtdbus/qdbusdeclaringslots.html
  3262. share/doc/qt5/qtdbus/qdbuserror-members.html
  3263. share/doc/qt5/qtdbus/qdbuserror.html
  3264. share/doc/qt5/qtdbus/qdbusinterface-members.html
  3265. share/doc/qt5/qtdbus/qdbusinterface-obsolete.html
  3266. share/doc/qt5/qtdbus/qdbusinterface.html
  3267. share/doc/qt5/qtdbus/qdbusmessage-members.html
  3268. share/doc/qt5/qtdbus/qdbusmessage.html
  3269. share/doc/qt5/qtdbus/qdbusobjectpath-members.html
  3270. share/doc/qt5/qtdbus/qdbusobjectpath.html
  3271. share/doc/qt5/qtdbus/qdbuspendingcall-members.html
  3272. share/doc/qt5/qtdbus/qdbuspendingcall.html
  3273. share/doc/qt5/qtdbus/qdbuspendingcallwatcher-members.html
  3274. share/doc/qt5/qtdbus/qdbuspendingcallwatcher-obsolete.html
  3275. share/doc/qt5/qtdbus/qdbuspendingcallwatcher.html
  3276. share/doc/qt5/qtdbus/qdbuspendingreply-members.html
  3277. share/doc/qt5/qtdbus/qdbuspendingreply.html
  3278. share/doc/qt5/qtdbus/qdbusreply-members.html
  3279. share/doc/qt5/qtdbus/qdbusreply.html
  3280. share/doc/qt5/qtdbus/qdbusserver-members.html
  3281. share/doc/qt5/qtdbus/qdbusserver-obsolete.html
  3282. share/doc/qt5/qtdbus/qdbusserver.html
  3283. share/doc/qt5/qtdbus/qdbusservicewatcher-members.html
  3284. share/doc/qt5/qtdbus/qdbusservicewatcher-obsolete.html
  3285. share/doc/qt5/qtdbus/qdbusservicewatcher.html
  3286. share/doc/qt5/qtdbus/qdbussignature-members.html
  3287. share/doc/qt5/qtdbus/qdbussignature.html
  3288. share/doc/qt5/qtdbus/qdbustypesystem.html
  3289. share/doc/qt5/qtdbus/qdbusunixfiledescriptor-members.html
  3290. share/doc/qt5/qtdbus/qdbusunixfiledescriptor.html
  3291. share/doc/qt5/qtdbus/qdbusvariant-members.html
  3292. share/doc/qt5/qtdbus/qdbusvariant.html
  3293. share/doc/qt5/qtdbus/qdbusviewer.html
  3294. share/doc/qt5/qtdbus/qdbusvirtualobject-members.html
  3295. share/doc/qt5/qtdbus/qdbusvirtualobject-obsolete.html
  3296. share/doc/qt5/qtdbus/qdbusvirtualobject.html
  3297. share/doc/qt5/qtdbus/qdbusxml2cpp.html
  3298. share/doc/qt5/qtdbus/qtdbus-attribution-libdbus-1-headers.html
  3299. share/doc/qt5/qtdbus/qtdbus-chat-chat-cpp.html
  3300. share/doc/qt5/qtdbus/qtdbus-chat-chat-h.html
  3301. share/doc/qt5/qtdbus/qtdbus-chat-chat-pro.html
  3302. share/doc/qt5/qtdbus/qtdbus-chat-chatmainwindow-ui.html
  3303. share/doc/qt5/qtdbus/qtdbus-chat-chatsetnickname-ui.html
  3304. share/doc/qt5/qtdbus/qtdbus-chat-example.html
  3305. share/doc/qt5/qtdbus/qtdbus-chat-org-example-chat-xml.html
  3306. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-cpp.html
  3307. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-h.html
  3308. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexping-pro.html
  3309. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpingpong-pro.html
  3310. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-cpp.html
  3311. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-h.html
  3312. share/doc/qt5/qtdbus/qtdbus-complexpingpong-complexpong-pro.html
  3313. share/doc/qt5/qtdbus/qtdbus-complexpingpong-example.html
  3314. share/doc/qt5/qtdbus/qtdbus-complexpingpong-ping-common-h.html
  3315. share/doc/qt5/qtdbus/qtdbus-index.html
  3316. share/doc/qt5/qtdbus/qtdbus-listnames-example.html
  3317. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-cpp.html
  3318. share/doc/qt5/qtdbus/qtdbus-listnames-listnames-pro.html
  3319. share/doc/qt5/qtdbus/qtdbus-module.html
  3320. share/doc/qt5/qtdbus/qtdbus-pingpong-example.html
  3321. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-common-h.html
  3322. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-cpp.html
  3323. share/doc/qt5/qtdbus/qtdbus-pingpong-ping-pro.html
  3324. share/doc/qt5/qtdbus/qtdbus-pingpong-pingpong-pro.html
  3325. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-cpp.html
  3326. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-h.html
  3327. share/doc/qt5/qtdbus/qtdbus-pingpong-pong-pro.html
  3328. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-cpp.html
  3329. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-h.html
  3330. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-pro.html
  3331. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-car-xml.html
  3332. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-car-main-cpp.html
  3333. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-car-xml.html
  3334. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-cpp.html
  3335. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-h.html
  3336. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-pro.html
  3337. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-controller-controller-ui.html
  3338. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-example.html
  3339. share/doc/qt5/qtdbus/qtdbus-remotecontrolledcar-remotecontrolledcar-pro.html
  3340. share/doc/qt5/qtdbus/qtdbus.index
  3341. share/doc/qt5/qtdbus/qtdbus.qhp
  3342. share/doc/qt5/qtdbus/qtdbus.qhp.sha1
  3343. share/doc/qt5/qtdbus/style/offline-simple.css
  3344. share/doc/qt5/qtdbus/style/offline.css
  3345. share/doc/qt5/qtdbus/usingadaptors.html
  3346. share/doc/qt5/qtdesigner.qch
  3347. share/doc/qt5/qtdesigner/designer-buddy-mode.html
  3348. share/doc/qt5/qtdesigner/designer-connection-mode.html
  3349. share/doc/qt5/qtdesigner/designer-creating-custom-widgets-extensions.html
  3350. share/doc/qt5/qtdesigner/designer-creating-custom-widgets.html
  3351. share/doc/qt5/qtdesigner/designer-creating-mainwindows.html
  3352. share/doc/qt5/qtdesigner/designer-customizing-forms.html
  3353. share/doc/qt5/qtdesigner/designer-editing-mode.html
  3354. share/doc/qt5/qtdesigner/designer-layouts.html
  3355. share/doc/qt5/qtdesigner/designer-preview.html
  3356. share/doc/qt5/qtdesigner/designer-quick-start.html
  3357. share/doc/qt5/qtdesigner/designer-resources.html
  3358. share/doc/qt5/qtdesigner/designer-stylesheet.html
  3359. share/doc/qt5/qtdesigner/designer-tab-order.html
  3360. share/doc/qt5/qtdesigner/designer-to-know.html
  3361. share/doc/qt5/qtdesigner/designer-ui-file-format.html
  3362. share/doc/qt5/qtdesigner/designer-using-a-ui-file.html
  3363. share/doc/qt5/qtdesigner/designer-using-containers.html
  3364. share/doc/qt5/qtdesigner/designer-using-custom-widgets.html
  3365. share/doc/qt5/qtdesigner/designer-widget-mode.html
  3366. share/doc/qt5/qtdesigner/examples-designer.html
  3367. share/doc/qt5/qtdesigner/examples-manifest.xml
  3368. share/doc/qt5/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
  3369. share/doc/qt5/qtdesigner/images/arrow_bc.png
  3370. share/doc/qt5/qtdesigner/images/bgrContent.png
  3371. share/doc/qt5/qtdesigner/images/btn_next.png
  3372. share/doc/qt5/qtdesigner/images/btn_prev.png
  3373. share/doc/qt5/qtdesigner/images/bullet_dn.png
  3374. share/doc/qt5/qtdesigner/images/bullet_sq.png
  3375. share/doc/qt5/qtdesigner/images/calculatorbuilder-example.png
  3376. share/doc/qt5/qtdesigner/images/calculatorform-example.png
  3377. share/doc/qt5/qtdesigner/images/containerextension-example.png
  3378. share/doc/qt5/qtdesigner/images/customwidgetplugin-example.png
  3379. share/doc/qt5/qtdesigner/images/designer-action-editor.png
  3380. share/doc/qt5/qtdesigner/images/designer-add-files-button.png
  3381. share/doc/qt5/qtdesigner/images/designer-add-resource-entry-button.png
  3382. share/doc/qt5/qtdesigner/images/designer-adding-dockwidget.png
  3383. share/doc/qt5/qtdesigner/images/designer-adding-menu-action.png
  3384. share/doc/qt5/qtdesigner/images/designer-adding-toolbar-action.png
  3385. share/doc/qt5/qtdesigner/images/designer-buddy-making.png
  3386. share/doc/qt5/qtdesigner/images/designer-buddy-mode.png
  3387. share/doc/qt5/qtdesigner/images/designer-buddy-tool.png
  3388. share/doc/qt5/qtdesigner/images/designer-choosing-form.png
  3389. share/doc/qt5/qtdesigner/images/designer-code-viewer.png
  3390. share/doc/qt5/qtdesigner/images/designer-connection-dialog.png
  3391. share/doc/qt5/qtdesigner/images/designer-connection-editing.png
  3392. share/doc/qt5/qtdesigner/images/designer-connection-editor.png
  3393. share/doc/qt5/qtdesigner/images/designer-connection-highlight.png
  3394. share/doc/qt5/qtdesigner/images/designer-connection-making.png
  3395. share/doc/qt5/qtdesigner/images/designer-connection-mode.png
  3396. share/doc/qt5/qtdesigner/images/designer-connection-to-form.png
  3397. share/doc/qt5/qtdesigner/images/designer-connection-tool.png
  3398. share/doc/qt5/qtdesigner/images/designer-containers-dockwidget.png
  3399. share/doc/qt5/qtdesigner/images/designer-containers-frame.png
  3400. share/doc/qt5/qtdesigner/images/designer-containers-groupbox.png
  3401. share/doc/qt5/qtdesigner/images/designer-containers-stackedwidget.png
  3402. share/doc/qt5/qtdesigner/images/designer-containers-tabwidget.png
  3403. share/doc/qt5/qtdesigner/images/designer-containers-toolbox.png
  3404. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry1.png
  3405. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry2.png
  3406. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry3.png
  3407. share/doc/qt5/qtdesigner/images/designer-creating-menu-entry4.png
  3408. share/doc/qt5/qtdesigner/images/designer-creating-menu1.png
  3409. share/doc/qt5/qtdesigner/images/designer-creating-menu2.png
  3410. share/doc/qt5/qtdesigner/images/designer-creating-menu3.png
  3411. share/doc/qt5/qtdesigner/images/designer-creating-menu4.png
  3412. share/doc/qt5/qtdesigner/images/designer-creating-toolbar.png
  3413. share/doc/qt5/qtdesigner/images/designer-dialog-preview.png
  3414. share/doc/qt5/qtdesigner/images/designer-dragging-onto-form.png
  3415. share/doc/qt5/qtdesigner/images/designer-edit-resource.png
  3416. share/doc/qt5/qtdesigner/images/designer-edit-resources-button.png
  3417. share/doc/qt5/qtdesigner/images/designer-editing-mode.png
  3418. share/doc/qt5/qtdesigner/images/designer-english-dialog.png
  3419. share/doc/qt5/qtdesigner/images/designer-file-menu.png
  3420. share/doc/qt5/qtdesigner/images/designer-form-layout-cleanlooks.png
  3421. share/doc/qt5/qtdesigner/images/designer-form-layout-macintosh.png
  3422. share/doc/qt5/qtdesigner/images/designer-form-layout-windowsXP.png
  3423. share/doc/qt5/qtdesigner/images/designer-form-layout.png
  3424. share/doc/qt5/qtdesigner/images/designer-form-layoutfunction.png
  3425. share/doc/qt5/qtdesigner/images/designer-form-settings.png
  3426. share/doc/qt5/qtdesigner/images/designer-form-viewcode.png
  3427. share/doc/qt5/qtdesigner/images/designer-french-dialog.png
  3428. share/doc/qt5/qtdesigner/images/designer-layout-inserting.png
  3429. share/doc/qt5/qtdesigner/images/designer-main-window.png
  3430. share/doc/qt5/qtdesigner/images/designer-manual-containerextension.png
  3431. share/doc/qt5/qtdesigner/images/designer-manual-membersheetextension.png
  3432. share/doc/qt5/qtdesigner/images/designer-manual-propertysheetextension.png
  3433. share/doc/qt5/qtdesigner/images/designer-manual-taskmenuextension.png
  3434. share/doc/qt5/qtdesigner/images/designer-multiple-screenshot.png
  3435. share/doc/qt5/qtdesigner/images/designer-object-inspector.png
  3436. share/doc/qt5/qtdesigner/images/designer-preview-deviceskin-selection.png
  3437. share/doc/qt5/qtdesigner/images/designer-preview-style-selection.png
  3438. share/doc/qt5/qtdesigner/images/designer-preview-style.png
  3439. share/doc/qt5/qtdesigner/images/designer-preview-stylesheet.png
  3440. share/doc/qt5/qtdesigner/images/designer-promoting-widgets.png
  3441. share/doc/qt5/qtdesigner/images/designer-property-editor-add-dynamic.png
  3442. share/doc/qt5/qtdesigner/images/designer-property-editor-configure.png
  3443. share/doc/qt5/qtdesigner/images/designer-property-editor-remove-dynamic.png
  3444. share/doc/qt5/qtdesigner/images/designer-property-editor-toolbar.png
  3445. share/doc/qt5/qtdesigner/images/designer-property-editor.png
  3446. share/doc/qt5/qtdesigner/images/designer-reload-resources-button.png
  3447. share/doc/qt5/qtdesigner/images/designer-remove-resource-entry-button.png
  3448. share/doc/qt5/qtdesigner/images/designer-removing-toolbar-action.png
  3449. share/doc/qt5/qtdesigner/images/designer-resource-browser.png
  3450. share/doc/qt5/qtdesigner/images/designer-resource-selector.png
  3451. share/doc/qt5/qtdesigner/images/designer-resources-editing.png
  3452. share/doc/qt5/qtdesigner/images/designer-resources-using.png
  3453. share/doc/qt5/qtdesigner/images/designer-screenshot.png
  3454. share/doc/qt5/qtdesigner/images/designer-selecting-widget.png
  3455. share/doc/qt5/qtdesigner/images/designer-set-layout.png
  3456. share/doc/qt5/qtdesigner/images/designer-set-layout2.png
  3457. share/doc/qt5/qtdesigner/images/designer-splitter-layout.png
  3458. share/doc/qt5/qtdesigner/images/designer-stylesheet-options.png
  3459. share/doc/qt5/qtdesigner/images/designer-stylesheet-usage.png
  3460. share/doc/qt5/qtdesigner/images/designer-tab-order-mode.png
  3461. share/doc/qt5/qtdesigner/images/designer-tab-order-tool.png
  3462. share/doc/qt5/qtdesigner/images/designer-widget-box.png
  3463. share/doc/qt5/qtdesigner/images/designer-widget-morph.png
  3464. share/doc/qt5/qtdesigner/images/designer-widget-tool.png
  3465. share/doc/qt5/qtdesigner/images/directapproach-calculatorform.png
  3466. share/doc/qt5/qtdesigner/images/home.png
  3467. share/doc/qt5/qtdesigner/images/ico_note.png
  3468. share/doc/qt5/qtdesigner/images/ico_note_attention.png
  3469. share/doc/qt5/qtdesigner/images/ico_out.png
  3470. share/doc/qt5/qtdesigner/images/logo.png
  3471. share/doc/qt5/qtdesigner/images/qtdesignerextensions.png
  3472. share/doc/qt5/qtdesigner/images/qtdesignerscreenshot.png
  3473. share/doc/qt5/qtdesigner/images/rgbController-arrangement.png
  3474. share/doc/qt5/qtdesigner/images/rgbController-configure-connection1.png
  3475. share/doc/qt5/qtdesigner/images/rgbController-configure-connection2.png
  3476. share/doc/qt5/qtdesigner/images/rgbController-final-layout.png
  3477. share/doc/qt5/qtdesigner/images/rgbController-form-gridLayout.png
  3478. share/doc/qt5/qtdesigner/images/rgbController-no-toplevel-layout.png
  3479. share/doc/qt5/qtdesigner/images/rgbController-property-editing.png
  3480. share/doc/qt5/qtdesigner/images/rgbController-screenshot.png
  3481. share/doc/qt5/qtdesigner/images/rgbController-selectForLayout.png
  3482. share/doc/qt5/qtdesigner/images/rgbController-signalsAndSlots.png
  3483. share/doc/qt5/qtdesigner/images/taskmenuextension-dialog.png
  3484. share/doc/qt5/qtdesigner/images/taskmenuextension-example-faded.png
  3485. share/doc/qt5/qtdesigner/images/taskmenuextension-menu.png
  3486. share/doc/qt5/qtdesigner/images/worldtimeclock-connection.png
  3487. share/doc/qt5/qtdesigner/images/worldtimeclock-signalandslot.png
  3488. share/doc/qt5/qtdesigner/images/worldtimeclockbuilder-example.png
  3489. share/doc/qt5/qtdesigner/images/worldtimeclockplugin-example.png
  3490. share/doc/qt5/qtdesigner/qabstractextensionfactory-members.html
  3491. share/doc/qt5/qtdesigner/qabstractextensionfactory.html
  3492. share/doc/qt5/qtdesigner/qabstractextensionmanager-members.html
  3493. share/doc/qt5/qtdesigner/qabstractextensionmanager.html
  3494. share/doc/qt5/qtdesigner/qabstractformbuilder-members.html
  3495. share/doc/qt5/qtdesigner/qabstractformbuilder.html
  3496. share/doc/qt5/qtdesigner/qdesigner-internal-actiondata-members.html
  3497. share/doc/qt5/qtdesigner/qdesigner-internal-actiondata.html
  3498. share/doc/qt5/qtdesigner/qdesigner-internal-actioneditor-members.html
  3499. share/doc/qt5/qtdesigner/qdesigner-internal-actioneditor.html
  3500. share/doc/qt5/qtdesigner/qdesigner-internal-actioninsertioncommand-members.html
  3501. share/doc/qt5/qtdesigner/qdesigner-internal-actioninsertioncommand.html
  3502. share/doc/qt5/qtdesigner/qdesigner-internal-actionlistview-members.html
  3503. share/doc/qt5/qtdesigner/qdesigner-internal-actionlistview.html
  3504. share/doc/qt5/qtdesigner/qdesigner-internal-actionmodel-members.html
  3505. share/doc/qt5/qtdesigner/qdesigner-internal-actionmodel.html
  3506. share/doc/qt5/qtdesigner/qdesigner-internal-actionrepositorymimedata-members.html
  3507. share/doc/qt5/qtdesigner/qdesigner-internal-actionrepositorymimedata.html
  3508. share/doc/qt5/qtdesigner/qdesigner-internal-actiontreeview-members.html
  3509. share/doc/qt5/qtdesigner/qdesigner-internal-actiontreeview.html
  3510. share/doc/qt5/qtdesigner/qdesigner-internal-actionview-members.html
  3511. share/doc/qt5/qtdesigner/qdesigner-internal-actionview.html
  3512. share/doc/qt5/qtdesigner/qdesigner-internal-addactioncommand-members.html
  3513. share/doc/qt5/qtdesigner/qdesigner-internal-addactioncommand.html
  3514. share/doc/qt5/qtdesigner/qdesigner-internal-addconnectioncommand-members.html
  3515. share/doc/qt5/qtdesigner/qdesigner-internal-addconnectioncommand.html
  3516. share/doc/qt5/qtdesigner/qdesigner-internal-addcontainerwidgetpagecommand-members.html
  3517. share/doc/qt5/qtdesigner/qdesigner-internal-addcontainerwidgetpagecommand.html
  3518. share/doc/qt5/qtdesigner/qdesigner-internal-adddockwidgetcommand-members.html
  3519. share/doc/qt5/qtdesigner/qdesigner-internal-adddockwidgetcommand.html
  3520. share/doc/qt5/qtdesigner/qdesigner-internal-adddynamicpropertycommand-members.html
  3521. share/doc/qt5/qtdesigner/qdesigner-internal-adddynamicpropertycommand.html
  3522. share/doc/qt5/qtdesigner/qdesigner-internal-addmenuactioncommand-members.html
  3523. share/doc/qt5/qtdesigner/qdesigner-internal-addmenuactioncommand.html
  3524. share/doc/qt5/qtdesigner/qdesigner-internal-addstackedwidgetpagecommand-members.html
  3525. share/doc/qt5/qtdesigner/qdesigner-internal-addstackedwidgetpagecommand.html
  3526. share/doc/qt5/qtdesigner/qdesigner-internal-addtabpagecommand-members.html
  3527. share/doc/qt5/qtdesigner/qdesigner-internal-addtabpagecommand.html
  3528. share/doc/qt5/qtdesigner/qdesigner-internal-addtoolbarcommand-members.html
  3529. share/doc/qt5/qtdesigner/qdesigner-internal-addtoolbarcommand.html
  3530. share/doc/qt5/qtdesigner/qdesigner-internal-addtoolboxpagecommand-members.html
  3531. share/doc/qt5/qtdesigner/qdesigner-internal-addtoolboxpagecommand.html
  3532. share/doc/qt5/qtdesigner/qdesigner-internal-adjustwidgetsizecommand-members.html
  3533. share/doc/qt5/qtdesigner/qdesigner-internal-adjustwidgetsizecommand.html
  3534. share/doc/qt5/qtdesigner/qdesigner-internal-breaklayoutcommand-members.html
  3535. share/doc/qt5/qtdesigner/qdesigner-internal-breaklayoutcommand.html
  3536. share/doc/qt5/qtdesigner/qdesigner-internal-cecommand-members.html
  3537. share/doc/qt5/qtdesigner/qdesigner-internal-cecommand.html
  3538. share/doc/qt5/qtdesigner/qdesigner-internal-cetypes-endpoint-members.html
  3539. share/doc/qt5/qtdesigner/qdesigner-internal-cetypes-endpoint.html
  3540. share/doc/qt5/qtdesigner/qdesigner-internal-cetypes-members.html
  3541. share/doc/qt5/qtdesigner/qdesigner-internal-cetypes.html
  3542. share/doc/qt5/qtdesigner/qdesigner-internal-changecurrentpagecommand-members.html
  3543. share/doc/qt5/qtdesigner/qdesigner-internal-changecurrentpagecommand.html
  3544. share/doc/qt5/qtdesigner/qdesigner-internal-changeformlayoutitemrolecommand-members.html
  3545. share/doc/qt5/qtdesigner/qdesigner-internal-changeformlayoutitemrolecommand.html
  3546. share/doc/qt5/qtdesigner/qdesigner-internal-changelayoutitemgeometry-members.html
  3547. share/doc/qt5/qtdesigner/qdesigner-internal-changelayoutitemgeometry.html
  3548. share/doc/qt5/qtdesigner/qdesigner-internal-changelistcontentscommand-members.html
  3549. share/doc/qt5/qtdesigner/qdesigner-internal-changelistcontentscommand.html
  3550. share/doc/qt5/qtdesigner/qdesigner-internal-changetablecontentscommand-members.html
  3551. share/doc/qt5/qtdesigner/qdesigner-internal-changetablecontentscommand.html
  3552. share/doc/qt5/qtdesigner/qdesigner-internal-changetreecontentscommand-members.html
  3553. share/doc/qt5/qtdesigner/qdesigner-internal-changetreecontentscommand.html
  3554. share/doc/qt5/qtdesigner/qdesigner-internal-changezordercommand-members.html
  3555. share/doc/qt5/qtdesigner/qdesigner-internal-changezordercommand.html
  3556. share/doc/qt5/qtdesigner/qdesigner-internal-codedialog-members.html
  3557. share/doc/qt5/qtdesigner/qdesigner-internal-codedialog.html
  3558. share/doc/qt5/qtdesigner/qdesigner-internal-connection-members.html
  3559. share/doc/qt5/qtdesigner/qdesigner-internal-connection.html
  3560. share/doc/qt5/qtdesigner/qdesigner-internal-connectionedit-members.html
  3561. share/doc/qt5/qtdesigner/qdesigner-internal-connectionedit.html
  3562. share/doc/qt5/qtdesigner/qdesigner-internal-containerwidgetcommand-members.html
  3563. share/doc/qt5/qtdesigner/qdesigner-internal-containerwidgetcommand.html
  3564. share/doc/qt5/qtdesigner/qdesigner-internal-createmenubarcommand-members.html
  3565. share/doc/qt5/qtdesigner/qdesigner-internal-createmenubarcommand.html
  3566. share/doc/qt5/qtdesigner/qdesigner-internal-createstatusbarcommand-members.html
  3567. share/doc/qt5/qtdesigner/qdesigner-internal-createstatusbarcommand.html
  3568. share/doc/qt5/qtdesigner/qdesigner-internal-createsubmenucommand-members.html
  3569. share/doc/qt5/qtdesigner/qdesigner-internal-createsubmenucommand.html
  3570. share/doc/qt5/qtdesigner/qdesigner-internal-csshighlighter-members.html
  3571. share/doc/qt5/qtdesigner/qdesigner-internal-csshighlighter.html
  3572. share/doc/qt5/qtdesigner/qdesigner-internal-cursorselectionstate-members.html
  3573. share/doc/qt5/qtdesigner/qdesigner-internal-cursorselectionstate.html
  3574. share/doc/qt5/qtdesigner/qdesigner-internal-deleteconnectionscommand-members.html
  3575. share/doc/qt5/qtdesigner/qdesigner-internal-deleteconnectionscommand.html
  3576. share/doc/qt5/qtdesigner/qdesigner-internal-deletecontainerwidgetpagecommand-members.html
  3577. share/doc/qt5/qtdesigner/qdesigner-internal-deletecontainerwidgetpagecommand.html
  3578. share/doc/qt5/qtdesigner/qdesigner-internal-deletemenubarcommand-members.html
  3579. share/doc/qt5/qtdesigner/qdesigner-internal-deletemenubarcommand.html
  3580. share/doc/qt5/qtdesigner/qdesigner-internal-deletestackedwidgetpagecommand-members.html
  3581. share/doc/qt5/qtdesigner/qdesigner-internal-deletestackedwidgetpagecommand.html
  3582. share/doc/qt5/qtdesigner/qdesigner-internal-deletestatusbarcommand-members.html
  3583. share/doc/qt5/qtdesigner/qdesigner-internal-deletestatusbarcommand.html
  3584. share/doc/qt5/qtdesigner/qdesigner-internal-deletetabpagecommand-members.html
  3585. share/doc/qt5/qtdesigner/qdesigner-internal-deletetabpagecommand.html
  3586. share/doc/qt5/qtdesigner/qdesigner-internal-deletetoolbarcommand-members.html
  3587. share/doc/qt5/qtdesigner/qdesigner-internal-deletetoolbarcommand.html
  3588. share/doc/qt5/qtdesigner/qdesigner-internal-deletetoolboxpagecommand-members.html
  3589. share/doc/qt5/qtdesigner/qdesigner-internal-deletetoolboxpagecommand.html
  3590. share/doc/qt5/qtdesigner/qdesigner-internal-deletewidgetcommand-members.html
  3591. share/doc/qt5/qtdesigner/qdesigner-internal-deletewidgetcommand.html
  3592. share/doc/qt5/qtdesigner/qdesigner-internal-demotefromcustomwidgetcommand-members.html
  3593. share/doc/qt5/qtdesigner/qdesigner-internal-demotefromcustomwidgetcommand.html
  3594. share/doc/qt5/qtdesigner/qdesigner-internal-designericoncache-members.html
  3595. share/doc/qt5/qtdesigner/qdesigner-internal-designericoncache.html
  3596. share/doc/qt5/qtdesigner/qdesigner-internal-designermetaenum-members.html
  3597. share/doc/qt5/qtdesigner/qdesigner-internal-designermetaenum.html
  3598. share/doc/qt5/qtdesigner/qdesigner-internal-designermetaflags-members.html
  3599. share/doc/qt5/qtdesigner/qdesigner-internal-designermetaflags.html
  3600. share/doc/qt5/qtdesigner/qdesigner-internal-designerpixmapcache-members.html
  3601. share/doc/qt5/qtdesigner/qdesigner-internal-designerpixmapcache.html
  3602. share/doc/qt5/qtdesigner/qdesigner-internal-deviceprofile-members.html
  3603. share/doc/qt5/qtdesigner/qdesigner-internal-deviceprofile.html
  3604. share/doc/qt5/qtdesigner/qdesigner-internal-dialoggui-members.html
  3605. share/doc/qt5/qtdesigner/qdesigner-internal-dialoggui.html
  3606. share/doc/qt5/qtdesigner/qdesigner-internal-dockwidgetcommand-members.html
  3607. share/doc/qt5/qtdesigner/qdesigner-internal-dockwidgetcommand.html
  3608. share/doc/qt5/qtdesigner/qdesigner-internal-extensionfactory-members.html
  3609. share/doc/qt5/qtdesigner/qdesigner-internal-extensionfactory.html
  3610. share/doc/qt5/qtdesigner/qdesigner-internal-formbuilderclipboard-members.html
  3611. share/doc/qt5/qtdesigner/qdesigner-internal-formbuilderclipboard.html
  3612. share/doc/qt5/qtdesigner/qdesigner-internal-formlayoutmenu-members.html
  3613. share/doc/qt5/qtdesigner/qdesigner-internal-formlayoutmenu.html
  3614. share/doc/qt5/qtdesigner/qdesigner-internal-formwindowbase-members.html
  3615. share/doc/qt5/qtdesigner/qdesigner-internal-formwindowbase.html
  3616. share/doc/qt5/qtdesigner/qdesigner-internal-grid-members.html
  3617. share/doc/qt5/qtdesigner/qdesigner-internal-grid.html
  3618. share/doc/qt5/qtdesigner/qdesigner-internal-gridpanel-members.html
  3619. share/doc/qt5/qtdesigner/qdesigner-internal-gridpanel.html
  3620. share/doc/qt5/qtdesigner/qdesigner-internal-htmlhighlighter-members.html
  3621. share/doc/qt5/qtdesigner/qdesigner-internal-htmlhighlighter.html
  3622. share/doc/qt5/qtdesigner/qdesigner-internal-iconselector-members.html
  3623. share/doc/qt5/qtdesigner/qdesigner-internal-iconselector.html
  3624. share/doc/qt5/qtdesigner/qdesigner-internal-iconthemeeditor-members.html
  3625. share/doc/qt5/qtdesigner/qdesigner-internal-iconthemeeditor.html
  3626. share/doc/qt5/qtdesigner/qdesigner-internal-insertactionintocommand-members.html
  3627. share/doc/qt5/qtdesigner/qdesigner-internal-insertactionintocommand.html
  3628. share/doc/qt5/qtdesigner/qdesigner-internal-insertwidgetcommand-members.html
  3629. share/doc/qt5/qtdesigner/qdesigner-internal-insertwidgetcommand.html
  3630. share/doc/qt5/qtdesigner/qdesigner-internal-invisiblewidget-members.html
  3631. share/doc/qt5/qtdesigner/qdesigner-internal-invisiblewidget.html
  3632. share/doc/qt5/qtdesigner/qdesigner-internal-itemdata-members.html
  3633. share/doc/qt5/qtdesigner/qdesigner-internal-itemdata.html
  3634. share/doc/qt5/qtdesigner/qdesigner-internal-languageresourcedialog-members.html
  3635. share/doc/qt5/qtdesigner/qdesigner-internal-languageresourcedialog.html
  3636. share/doc/qt5/qtdesigner/qdesigner-internal-layoutalignmentcommand-members.html
  3637. share/doc/qt5/qtdesigner/qdesigner-internal-layoutalignmentcommand.html
  3638. share/doc/qt5/qtdesigner/qdesigner-internal-layoutcommand-members.html
  3639. share/doc/qt5/qtdesigner/qdesigner-internal-layoutcommand.html
  3640. share/doc/qt5/qtdesigner/qdesigner-internal-layouthelper-members.html
  3641. share/doc/qt5/qtdesigner/qdesigner-internal-layouthelper.html
  3642. share/doc/qt5/qtdesigner/qdesigner-internal-layoutinfo-members.html
  3643. share/doc/qt5/qtdesigner/qdesigner-internal-layoutinfo.html
  3644. share/doc/qt5/qtdesigner/qdesigner-internal-layoutproperties-members.html
  3645. share/doc/qt5/qtdesigner/qdesigner-internal-layoutproperties.html
  3646. share/doc/qt5/qtdesigner/qdesigner-internal-listcontents-members.html
  3647. share/doc/qt5/qtdesigner/qdesigner-internal-listcontents.html
  3648. share/doc/qt5/qtdesigner/qdesigner-internal-lowerwidgetcommand-members.html
  3649. share/doc/qt5/qtdesigner/qdesigner-internal-lowerwidgetcommand.html
  3650. share/doc/qt5/qtdesigner/qdesigner-internal-managewidgetcommandhelper-members.html
  3651. share/doc/qt5/qtdesigner/qdesigner-internal-managewidgetcommandhelper.html
  3652. share/doc/qt5/qtdesigner/qdesigner-internal-menuactioncommand-members.html
  3653. share/doc/qt5/qtdesigner/qdesigner-internal-menuactioncommand.html
  3654. share/doc/qt5/qtdesigner/qdesigner-internal-metadatabase-members.html
  3655. share/doc/qt5/qtdesigner/qdesigner-internal-metadatabase.html
  3656. share/doc/qt5/qtdesigner/qdesigner-internal-metadatabaseitem-members.html
  3657. share/doc/qt5/qtdesigner/qdesigner-internal-metadatabaseitem.html
  3658. share/doc/qt5/qtdesigner/qdesigner-internal-metaenum-members.html
  3659. share/doc/qt5/qtdesigner/qdesigner-internal-metaenum.html
  3660. share/doc/qt5/qtdesigner/qdesigner-internal-morphlayoutcommand-members.html
  3661. share/doc/qt5/qtdesigner/qdesigner-internal-morphlayoutcommand.html
  3662. share/doc/qt5/qtdesigner/qdesigner-internal-morphmenu-members.html
  3663. share/doc/qt5/qtdesigner/qdesigner-internal-morphmenu.html
  3664. share/doc/qt5/qtdesigner/qdesigner-internal-movestackedwidgetcommand-members.html
  3665. share/doc/qt5/qtdesigner/qdesigner-internal-movestackedwidgetcommand.html
  3666. share/doc/qt5/qtdesigner/qdesigner-internal-movetabpagecommand-members.html
  3667. share/doc/qt5/qtdesigner/qdesigner-internal-movetabpagecommand.html
  3668. share/doc/qt5/qtdesigner/qdesigner-internal-movetoolboxpagecommand-members.html
  3669. share/doc/qt5/qtdesigner/qdesigner-internal-movetoolboxpagecommand.html
  3670. share/doc/qt5/qtdesigner/qdesigner-internal-newactiondialog-members.html
  3671. share/doc/qt5/qtdesigner/qdesigner-internal-newactiondialog.html
  3672. share/doc/qt5/qtdesigner/qdesigner-internal-newformwidget-members.html
  3673. share/doc/qt5/qtdesigner/qdesigner-internal-newformwidget.html
  3674. share/doc/qt5/qtdesigner/qdesigner-internal-newformwidgetformbuilder-members.html
  3675. share/doc/qt5/qtdesigner/qdesigner-internal-newformwidgetformbuilder.html
  3676. share/doc/qt5/qtdesigner/qdesigner-internal-newpromotedclasspanel-members.html
  3677. share/doc/qt5/qtdesigner/qdesigner-internal-newpromotedclasspanel.html
  3678. share/doc/qt5/qtdesigner/qdesigner-internal-orderdialog-members.html
  3679. share/doc/qt5/qtdesigner/qdesigner-internal-orderdialog.html
  3680. share/doc/qt5/qtdesigner/qdesigner-internal-plaintexteditordialog-members.html
  3681. share/doc/qt5/qtdesigner/qdesigner-internal-plaintexteditordialog.html
  3682. share/doc/qt5/qtdesigner/qdesigner-internal-plugindialog-members.html
  3683. share/doc/qt5/qtdesigner/qdesigner-internal-plugindialog.html
  3684. share/doc/qt5/qtdesigner/qdesigner-internal-previewconfiguration-members.html
  3685. share/doc/qt5/qtdesigner/qdesigner-internal-previewconfiguration.html
  3686. share/doc/qt5/qtdesigner/qdesigner-internal-previewconfigurationwidget-members.html
  3687. share/doc/qt5/qtdesigner/qdesigner-internal-previewconfigurationwidget.html
  3688. share/doc/qt5/qtdesigner/qdesigner-internal-previewmanager-members.html
  3689. share/doc/qt5/qtdesigner/qdesigner-internal-previewmanager.html
  3690. share/doc/qt5/qtdesigner/qdesigner-internal-promotetocustomwidgetcommand-members.html
  3691. share/doc/qt5/qtdesigner/qdesigner-internal-promotetocustomwidgetcommand.html
  3692. share/doc/qt5/qtdesigner/qdesigner-internal-promotionmodel-members.html
  3693. share/doc/qt5/qtdesigner/qdesigner-internal-promotionmodel-modeldata-members.html
  3694. share/doc/qt5/qtdesigner/qdesigner-internal-promotionmodel-modeldata.html
  3695. share/doc/qt5/qtdesigner/qdesigner-internal-promotionmodel.html
  3696. share/doc/qt5/qtdesigner/qdesigner-internal-promotiontaskmenu-members.html
  3697. share/doc/qt5/qtdesigner/qdesigner-internal-promotiontaskmenu.html
  3698. share/doc/qt5/qtdesigner/qdesigner-internal-propertyhelper-members.html
  3699. share/doc/qt5/qtdesigner/qdesigner-internal-propertyhelper.html
  3700. share/doc/qt5/qtdesigner/qdesigner-internal-propertylineedit-members.html
  3701. share/doc/qt5/qtdesigner/qdesigner-internal-propertylineedit.html
  3702. share/doc/qt5/qtdesigner/qdesigner-internal-propertylistcommand-members.html
  3703. share/doc/qt5/qtdesigner/qdesigner-internal-propertylistcommand-propertydescription-members.html
  3704. share/doc/qt5/qtdesigner/qdesigner-internal-propertylistcommand-propertydescription.html
  3705. share/doc/qt5/qtdesigner/qdesigner-internal-propertylistcommand.html
  3706. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetenumvalue-members.html
  3707. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetenumvalue.html
  3708. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetflagvalue-members.html
  3709. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetflagvalue.html
  3710. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheeticonvalue-members.html
  3711. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheeticonvalue.html
  3712. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetkeysequencevalue-members.html
  3713. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetkeysequencevalue.html
  3714. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetpixmapvalue-members.html
  3715. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetpixmapvalue.html
  3716. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetstringlistvalue-members.html
  3717. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetstringlistvalue.html
  3718. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetstringvalue-members.html
  3719. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheetstringvalue.html
  3720. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheettranslatabledata-members.html
  3721. share/doc/qt5/qtdesigner/qdesigner-internal-propertysheettranslatabledata.html
  3722. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerdnditem-members.html
  3723. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerdnditem.html
  3724. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformbuilder-members.html
  3725. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformbuilder.html
  3726. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformeditorcommand-members.html
  3727. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformeditorcommand.html
  3728. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformwindowcommand-members.html
  3729. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformwindowcommand.html
  3730. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformwindowmanager-members.html
  3731. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformwindowmanager-obsolete.html
  3732. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerformwindowmanager.html
  3733. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerintrospection-members.html
  3734. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerintrospection.html
  3735. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignermimedata-members.html
  3736. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignermimedata.html
  3737. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerobjectinspector-members.html
  3738. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerobjectinspector.html
  3739. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpromotion-members.html
  3740. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpromotion.html
  3741. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpromotiondialog-members.html
  3742. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpromotiondialog.html
  3743. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpropertyeditor-members.html
  3744. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerpropertyeditor.html
  3745. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignersharedsettings-members.html
  3746. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignersharedsettings.html
  3747. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignertaskmenu-members.html
  3748. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignertaskmenu.html
  3749. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetbox-members.html
  3750. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetbox.html
  3751. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetitem-members.html
  3752. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetitem.html
  3753. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetiteminstaller-members.html
  3754. share/doc/qt5/qtdesigner/qdesigner-internal-qdesignerwidgetiteminstaller.html
  3755. share/doc/qt5/qtdesigner/qdesigner-internal-qeditorformbuilder-members.html
  3756. share/doc/qt5/qtdesigner/qdesigner-internal-qeditorformbuilder.html
  3757. share/doc/qt5/qtdesigner/qdesigner-internal-qlayoutsupport-members.html
  3758. share/doc/qt5/qtdesigner/qdesigner-internal-qlayoutsupport.html
  3759. share/doc/qt5/qtdesigner/qdesigner-internal-qsimpleresource-members.html
  3760. share/doc/qt5/qtdesigner/qdesigner-internal-qsimpleresource.html
  3761. share/doc/qt5/qtdesigner/qdesigner-internal-raisewidgetcommand-members.html
  3762. share/doc/qt5/qtdesigner/qdesigner-internal-raisewidgetcommand.html
  3763. share/doc/qt5/qtdesigner/qdesigner-internal-removeactioncommand-actiondataitem-members.html
  3764. share/doc/qt5/qtdesigner/qdesigner-internal-removeactioncommand-actiondataitem.html
  3765. share/doc/qt5/qtdesigner/qdesigner-internal-removeactioncommand-members.html
  3766. share/doc/qt5/qtdesigner/qdesigner-internal-removeactioncommand.html
  3767. share/doc/qt5/qtdesigner/qdesigner-internal-removeactionfromcommand-members.html
  3768. share/doc/qt5/qtdesigner/qdesigner-internal-removeactionfromcommand.html
  3769. share/doc/qt5/qtdesigner/qdesigner-internal-removedynamicpropertycommand-members.html
  3770. share/doc/qt5/qtdesigner/qdesigner-internal-removedynamicpropertycommand.html
  3771. share/doc/qt5/qtdesigner/qdesigner-internal-removemenuactioncommand-members.html
  3772. share/doc/qt5/qtdesigner/qdesigner-internal-removemenuactioncommand.html
  3773. share/doc/qt5/qtdesigner/qdesigner-internal-reparentwidgetcommand-members.html
  3774. share/doc/qt5/qtdesigner/qdesigner-internal-reparentwidgetcommand.html
  3775. share/doc/qt5/qtdesigner/qdesigner-internal-resetpropertycommand-members.html
  3776. share/doc/qt5/qtdesigner/qdesigner-internal-resetpropertycommand.html
  3777. share/doc/qt5/qtdesigner/qdesigner-internal-richtexteditordialog-members.html
  3778. share/doc/qt5/qtdesigner/qdesigner-internal-richtexteditordialog.html
  3779. share/doc/qt5/qtdesigner/qdesigner-internal-selection-members.html
  3780. share/doc/qt5/qtdesigner/qdesigner-internal-selection.html
  3781. share/doc/qt5/qtdesigner/qdesigner-internal-selectsignaldialog-members.html
  3782. share/doc/qt5/qtdesigner/qdesigner-internal-selectsignaldialog-method-members.html
  3783. share/doc/qt5/qtdesigner/qdesigner-internal-selectsignaldialog-method.html
  3784. share/doc/qt5/qtdesigner/qdesigner-internal-selectsignaldialog.html
  3785. share/doc/qt5/qtdesigner/qdesigner-internal-setpropertycommand-members.html
  3786. share/doc/qt5/qtdesigner/qdesigner-internal-setpropertycommand.html
  3787. share/doc/qt5/qtdesigner/qdesigner-internal-sheetdelegate-members.html
  3788. share/doc/qt5/qtdesigner/qdesigner-internal-sheetdelegate.html
  3789. share/doc/qt5/qtdesigner/qdesigner-internal-signalslotdialog-members.html
  3790. share/doc/qt5/qtdesigner/qdesigner-internal-signalslotdialog.html
  3791. share/doc/qt5/qtdesigner/qdesigner-internal-signalslotdialogdata-members.html
  3792. share/doc/qt5/qtdesigner/qdesigner-internal-signalslotdialogdata.html
  3793. share/doc/qt5/qtdesigner/qdesigner-internal-signaturemodel-members.html
  3794. share/doc/qt5/qtdesigner/qdesigner-internal-signaturemodel.html
  3795. share/doc/qt5/qtdesigner/qdesigner-internal-signaturepanel-members.html
  3796. share/doc/qt5/qtdesigner/qdesigner-internal-signaturepanel.html
  3797. share/doc/qt5/qtdesigner/qdesigner-internal-simplifylayoutcommand-members.html
  3798. share/doc/qt5/qtdesigner/qdesigner-internal-simplifylayoutcommand.html
  3799. share/doc/qt5/qtdesigner/qdesigner-internal-specialmenuaction-members.html
  3800. share/doc/qt5/qtdesigner/qdesigner-internal-specialmenuaction.html
  3801. share/doc/qt5/qtdesigner/qdesigner-internal-stackedwidgetcommand-members.html
  3802. share/doc/qt5/qtdesigner/qdesigner-internal-stackedwidgetcommand.html
  3803. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheeteditor-members.html
  3804. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheeteditor.html
  3805. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheeteditordialog-members.html
  3806. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheeteditordialog.html
  3807. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheetpropertyeditordialog-members.html
  3808. share/doc/qt5/qtdesigner/qdesigner-internal-stylesheetpropertyeditordialog.html
  3809. share/doc/qt5/qtdesigner/qdesigner-internal-sub-qtdesigner.html
  3810. share/doc/qt5/qtdesigner/qdesigner-internal-tablewidgetcontents-members.html
  3811. share/doc/qt5/qtdesigner/qdesigner-internal-tablewidgetcontents.html
  3812. share/doc/qt5/qtdesigner/qdesigner-internal-tabordercommand-members.html
  3813. share/doc/qt5/qtdesigner/qdesigner-internal-tabordercommand.html
  3814. share/doc/qt5/qtdesigner/qdesigner-internal-tabwidgetcommand-members.html
  3815. share/doc/qt5/qtdesigner/qdesigner-internal-tabwidgetcommand.html
  3816. share/doc/qt5/qtdesigner/qdesigner-internal-textpropertyeditor-members.html
  3817. share/doc/qt5/qtdesigner/qdesigner-internal-textpropertyeditor.html
  3818. share/doc/qt5/qtdesigner/qdesigner-internal-toolbareventfilter-members.html
  3819. share/doc/qt5/qtdesigner/qdesigner-internal-toolbareventfilter.html
  3820. share/doc/qt5/qtdesigner/qdesigner-internal-toolboxcommand-members.html
  3821. share/doc/qt5/qtdesigner/qdesigner-internal-toolboxcommand.html
  3822. share/doc/qt5/qtdesigner/qdesigner-internal-treewidgetcontents-itemcontents-members.html
  3823. share/doc/qt5/qtdesigner/qdesigner-internal-treewidgetcontents-itemcontents.html
  3824. share/doc/qt5/qtdesigner/qdesigner-internal-treewidgetcontents-members.html
  3825. share/doc/qt5/qtdesigner/qdesigner-internal-treewidgetcontents.html
  3826. share/doc/qt5/qtdesigner/qdesigner-internal-updateblocker-members.html
  3827. share/doc/qt5/qtdesigner/qdesigner-internal-updateblocker.html
  3828. share/doc/qt5/qtdesigner/qdesigner-internal-widgetdatabase-members.html
  3829. share/doc/qt5/qtdesigner/qdesigner-internal-widgetdatabase.html
  3830. share/doc/qt5/qtdesigner/qdesigner-internal-widgetdatabaseitem-members.html
  3831. share/doc/qt5/qtdesigner/qdesigner-internal-widgetdatabaseitem.html
  3832. share/doc/qt5/qtdesigner/qdesigner-internal-widgetfactory-members.html
  3833. share/doc/qt5/qtdesigner/qdesigner-internal-widgetfactory.html
  3834. share/doc/qt5/qtdesigner/qdesigner-internal-zoommenu-members.html
  3835. share/doc/qt5/qtdesigner/qdesigner-internal-zoommenu.html
  3836. share/doc/qt5/qtdesigner/qdesigner-internal-zoomproxywidget-members.html
  3837. share/doc/qt5/qtdesigner/qdesigner-internal-zoomproxywidget.html
  3838. share/doc/qt5/qtdesigner/qdesigner-internal-zoomview-members.html
  3839. share/doc/qt5/qtdesigner/qdesigner-internal-zoomview.html
  3840. share/doc/qt5/qtdesigner/qdesigner-internal-zoomwidget-members.html
  3841. share/doc/qt5/qtdesigner/qdesigner-internal-zoomwidget.html
  3842. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface-members.html
  3843. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface-obsolete.html
  3844. share/doc/qt5/qtdesigner/qdesigneractioneditorinterface.html
  3845. share/doc/qt5/qtdesigner/qdesignercontainerextension-members.html
  3846. share/doc/qt5/qtdesigner/qdesignercontainerextension.html
  3847. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
  3848. share/doc/qt5/qtdesigner/qdesignercustomwidgetcollectioninterface.html
  3849. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface-members.html
  3850. share/doc/qt5/qtdesigner/qdesignercustomwidgetinterface.html
  3851. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
  3852. share/doc/qt5/qtdesigner/qdesignerdynamicpropertysheetextension.html
  3853. share/doc/qt5/qtdesigner/qdesignerformeditorinterface-members.html
  3854. share/doc/qt5/qtdesigner/qdesignerformeditorinterface-obsolete.html
  3855. share/doc/qt5/qtdesigner/qdesignerformeditorinterface.html
  3856. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface-members.html
  3857. share/doc/qt5/qtdesigner/qdesignerformwindowcursorinterface.html
  3858. share/doc/qt5/qtdesigner/qdesignerformwindowinterface-members.html
  3859. share/doc/qt5/qtdesigner/qdesignerformwindowinterface-obsolete.html
  3860. share/doc/qt5/qtdesigner/qdesignerformwindowinterface.html
  3861. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-members.html
  3862. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
  3863. share/doc/qt5/qtdesigner/qdesignerformwindowmanagerinterface.html
  3864. share/doc/qt5/qtdesigner/qdesignermembersheetextension-members.html
  3865. share/doc/qt5/qtdesigner/qdesignermembersheetextension.html
  3866. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface-members.html
  3867. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface-obsolete.html
  3868. share/doc/qt5/qtdesigner/qdesignerobjectinspectorinterface.html
  3869. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface-members.html
  3870. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface-obsolete.html
  3871. share/doc/qt5/qtdesigner/qdesignerpropertyeditorinterface.html
  3872. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension-members.html
  3873. share/doc/qt5/qtdesigner/qdesignerpropertysheetextension.html
  3874. share/doc/qt5/qtdesigner/qdesignertaskmenuextension-members.html
  3875. share/doc/qt5/qtdesigner/qdesignertaskmenuextension.html
  3876. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface-members.html
  3877. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface-obsolete.html
  3878. share/doc/qt5/qtdesigner/qdesignerwidgetboxinterface.html
  3879. share/doc/qt5/qtdesigner/qextensionfactory-members.html
  3880. share/doc/qt5/qtdesigner/qextensionfactory-obsolete.html
  3881. share/doc/qt5/qtdesigner/qextensionfactory.html
  3882. share/doc/qt5/qtdesigner/qextensionmanager-members.html
  3883. share/doc/qt5/qtdesigner/qextensionmanager-obsolete.html
  3884. share/doc/qt5/qtdesigner/qextensionmanager.html
  3885. share/doc/qt5/qtdesigner/qformbuilder-members.html
  3886. share/doc/qt5/qtdesigner/qformbuilder.html
  3887. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-pro.html
  3888. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorbuilder-qrc.html
  3889. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-cpp.html
  3890. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-h.html
  3891. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-calculatorform-ui.html
  3892. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-example.html
  3893. share/doc/qt5/qtdesigner/qtdesigner-calculatorbuilder-main-cpp.html
  3894. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-cpp.html
  3895. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-h.html
  3896. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-pro.html
  3897. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-calculatorform-ui.html
  3898. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-example.html
  3899. share/doc/qt5/qtdesigner/qtdesigner-calculatorform-main-cpp.html
  3900. share/doc/qt5/qtdesigner/qtdesigner-components.html
  3901. share/doc/qt5/qtdesigner/qtdesigner-containerextension-containerextension-pro.html
  3902. share/doc/qt5/qtdesigner/qtdesigner-containerextension-example.html
  3903. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-cpp.html
  3904. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidget-h.html
  3905. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-cpp.html
  3906. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetcontainerextension-h.html
  3907. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-cpp.html
  3908. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetextensionfactory-h.html
  3909. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-cpp.html
  3910. share/doc/qt5/qtdesigner/qtdesigner-containerextension-multipagewidgetplugin-h.html
  3911. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-cpp.html
  3912. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-analogclock-h.html
  3913. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-cpp.html
  3914. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-h.html
  3915. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-customwidgetplugin-pro.html
  3916. share/doc/qt5/qtdesigner/qtdesigner-customwidgetplugin-example.html
  3917. share/doc/qt5/qtdesigner/qtdesigner-index.html
  3918. share/doc/qt5/qtdesigner/qtdesigner-manual.html
  3919. share/doc/qt5/qtdesigner/qtdesigner-module.html
  3920. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-example.html
  3921. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-taskmenuextension-pro.html
  3922. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-cpp.html
  3923. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoe-h.html
  3924. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-cpp.html
  3925. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoedialog-h.html
  3926. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-cpp.html
  3927. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoeplugin-h.html
  3928. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-cpp.html
  3929. share/doc/qt5/qtdesigner/qtdesigner-taskmenuextension-tictactoetaskmenu-h.html
  3930. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
  3931. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-form-ui.html
  3932. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-main-cpp.html
  3933. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-pro.html
  3934. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockbuilder-worldtimeclockbuilder-qrc.html
  3935. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
  3936. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-cpp.html
  3937. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclock-h.html
  3938. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-cpp.html
  3939. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-h.html
  3940. share/doc/qt5/qtdesigner/qtdesigner-worldtimeclockplugin-worldtimeclockplugin-pro.html
  3941. share/doc/qt5/qtdesigner/qtdesigner.index
  3942. share/doc/qt5/qtdesigner/qtdesigner.qhp
  3943. share/doc/qt5/qtdesigner/qtdesigner.qhp.sha1
  3944. share/doc/qt5/qtdesigner/style/offline-simple.css
  3945. share/doc/qt5/qtdesigner/style/offline.css
  3946. share/doc/qt5/qtdistancefieldgenerator.qch
  3947. share/doc/qt5/qtdistancefieldgenerator/images/arrow_bc.png
  3948. share/doc/qt5/qtdistancefieldgenerator/images/bgrContent.png
  3949. share/doc/qt5/qtdistancefieldgenerator/images/btn_next.png
  3950. share/doc/qt5/qtdistancefieldgenerator/images/btn_prev.png
  3951. share/doc/qt5/qtdistancefieldgenerator/images/bullet_dn.png
  3952. share/doc/qt5/qtdistancefieldgenerator/images/bullet_sq.png
  3953. share/doc/qt5/qtdistancefieldgenerator/images/distancefieldgenerator.png
  3954. share/doc/qt5/qtdistancefieldgenerator/images/home.png
  3955. share/doc/qt5/qtdistancefieldgenerator/images/ico_note.png
  3956. share/doc/qt5/qtdistancefieldgenerator/images/ico_note_attention.png
  3957. share/doc/qt5/qtdistancefieldgenerator/images/ico_out.png
  3958. share/doc/qt5/qtdistancefieldgenerator/images/logo.png
  3959. share/doc/qt5/qtdistancefieldgenerator/qtdistancefieldgenerator-index.html
  3960. share/doc/qt5/qtdistancefieldgenerator/qtdistancefieldgenerator.index
  3961. share/doc/qt5/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp
  3962. share/doc/qt5/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp.sha1
  3963. share/doc/qt5/qtdistancefieldgenerator/style/offline-simple.css
  3964. share/doc/qt5/qtdistancefieldgenerator/style/offline.css
  3965. share/doc/qt5/qtdoc.qch
  3966. share/doc/qt5/qtdoc/accelerators.html
  3967. share/doc/qt5/qtdoc/accessibility.html
  3968. share/doc/qt5/qtdoc/accessible-qtquick.html
  3969. share/doc/qt5/qtdoc/accessible-qwidget.html
  3970. share/doc/qt5/qtdoc/accessible.html
  3971. share/doc/qt5/qtdoc/activeqt-idc.html
  3972. share/doc/qt5/qtdoc/activeqt-testcon.html
  3973. share/doc/qt5/qtdoc/activeqt.html
  3974. share/doc/qt5/qtdoc/all-examples.html
  3975. share/doc/qt5/qtdoc/android-3rdparty-libs.html
  3976. share/doc/qt5/qtdoc/android-getting-started.html
  3977. share/doc/qt5/qtdoc/android-openssl-support.html
  3978. share/doc/qt5/qtdoc/android-platform-notes.html
  3979. share/doc/qt5/qtdoc/android-publishing-to-googleplay.html
  3980. share/doc/qt5/qtdoc/android-runtime-licensing-notes.html
  3981. share/doc/qt5/qtdoc/android-services.html
  3982. share/doc/qt5/qtdoc/android.html
  3983. share/doc/qt5/qtdoc/annotated.html
  3984. share/doc/qt5/qtdoc/appicon.html
  3985. share/doc/qt5/qtdoc/atomic-operations.html
  3986. share/doc/qt5/qtdoc/best-practices.html
  3987. share/doc/qt5/qtdoc/bughowto.html
  3988. share/doc/qt5/qtdoc/build-sources.html
  3989. share/doc/qt5/qtdoc/classes.html
  3990. share/doc/qt5/qtdoc/classesandfunctions.html
  3991. share/doc/qt5/qtdoc/cmake-manual.html
  3992. share/doc/qt5/qtdoc/commerciallicense.html
  3993. share/doc/qt5/qtdoc/configure-options.html
  3994. share/doc/qt5/qtdoc/debug.html
  3995. share/doc/qt5/qtdoc/demos-manifest.xml
  3996. share/doc/qt5/qtdoc/deployment-android.html
  3997. share/doc/qt5/qtdoc/deployment-plugins.html
  3998. share/doc/qt5/qtdoc/deployment.html
  3999. share/doc/qt5/qtdoc/desktop-integration.html
  4000. share/doc/qt5/qtdoc/embedded-linux.html
  4001. share/doc/qt5/qtdoc/examples-activeqt.html
  4002. share/doc/qt5/qtdoc/examples-android.html
  4003. share/doc/qt5/qtdoc/examples-animation.html
  4004. share/doc/qt5/qtdoc/examples-draganddrop.html
  4005. share/doc/qt5/qtdoc/examples-gestures.html
  4006. share/doc/qt5/qtdoc/examples-ios.html
  4007. share/doc/qt5/qtdoc/examples-ipc.html
  4008. share/doc/qt5/qtdoc/examples-layouts.html
  4009. share/doc/qt5/qtdoc/examples-license.html
  4010. share/doc/qt5/qtdoc/examples-manifest.xml
  4011. share/doc/qt5/qtdoc/examples-sql.html
  4012. share/doc/qt5/qtdoc/examples-statemachine.html
  4013. share/doc/qt5/qtdoc/examples-threadandconcurrent.html
  4014. share/doc/qt5/qtdoc/examples-widgets-tools.html
  4015. share/doc/qt5/qtdoc/examples-xml.html
  4016. share/doc/qt5/qtdoc/exceptionsafety.html
  4017. share/doc/qt5/qtdoc/fdl.html
  4018. share/doc/qt5/qtdoc/functions.html
  4019. share/doc/qt5/qtdoc/gettingstarted.html
  4020. share/doc/qt5/qtdoc/gpl.html
  4021. share/doc/qt5/qtdoc/groups.html
  4022. share/doc/qt5/qtdoc/hierarchy.html
  4023. share/doc/qt5/qtdoc/highdpi.html
  4024. share/doc/qt5/qtdoc/i18n-plural-rules.html
  4025. share/doc/qt5/qtdoc/i18n-source-translation.html
  4026. share/doc/qt5/qtdoc/i18n.html
  4027. share/doc/qt5/qtdoc/images/I5jasWrsxT0.jpg
  4028. share/doc/qt5/qtdoc/images/accessibleobjecttree.png
  4029. share/doc/qt5/qtdoc/images/activeqt-examples.png
  4030. share/doc/qt5/qtdoc/images/addalarms.png
  4031. share/doc/qt5/qtdoc/images/alarms2.png
  4032. share/doc/qt5/qtdoc/images/alarms3.png
  4033. share/doc/qt5/qtdoc/images/animatedtiles_snapshot.png
  4034. share/doc/qt5/qtdoc/images/animation-examples.png
  4035. share/doc/qt5/qtdoc/images/applicationwindow.png
  4036. share/doc/qt5/qtdoc/images/arrow_bc.png
  4037. share/doc/qt5/qtdoc/images/bgrContent.png
  4038. share/doc/qt5/qtdoc/images/btn_next.png
  4039. share/doc/qt5/qtdoc/images/btn_prev.png
  4040. share/doc/qt5/qtdoc/images/bullet_dn.png
  4041. share/doc/qt5/qtdoc/images/bullet_sq.png
  4042. share/doc/qt5/qtdoc/images/coffee_machine_emptycup.png
  4043. share/doc/qt5/qtdoc/images/coffee_machine_modify.png
  4044. share/doc/qt5/qtdoc/images/coffee_machine_overview.png
  4045. share/doc/qt5/qtdoc/images/coffee_machine_selection.png
  4046. share/doc/qt5/qtdoc/images/controlstexteditor_designer.png
  4047. share/doc/qt5/qtdoc/images/controlstexteditor_main.png
  4048. share/doc/qt5/qtdoc/images/controlstexteditor_navigator.png
  4049. share/doc/qt5/qtdoc/images/controlstexteditor_newproperties.png
  4050. share/doc/qt5/qtdoc/images/controlstexteditor_openproperties.png
  4051. share/doc/qt5/qtdoc/images/controlstexteditor_rowproperties.png
  4052. share/doc/qt5/qtdoc/images/deployment-mac-application.png
  4053. share/doc/qt5/qtdoc/images/deployment-mac-bundlestructure.png
  4054. share/doc/qt5/qtdoc/images/deployment-windows-depends.png
  4055. share/doc/qt5/qtdoc/images/detailscreen.png
  4056. share/doc/qt5/qtdoc/images/draganddrop-examples.png
  4057. share/doc/qt5/qtdoc/images/flickr_application.png
  4058. share/doc/qt5/qtdoc/images/home.png
  4059. share/doc/qt5/qtdoc/images/ico_note.png
  4060. share/doc/qt5/qtdoc/images/ico_note_attention.png
  4061. share/doc/qt5/qtdoc/images/ico_out.png
  4062. share/doc/qt5/qtdoc/images/icon_QtCreator_78x78px.png
  4063. share/doc/qt5/qtdoc/images/icon_Qt_78x78px.png
  4064. share/doc/qt5/qtdoc/images/icon_Tools.png
  4065. share/doc/qt5/qtdoc/images/kernel-settings.png
  4066. share/doc/qt5/qtdoc/images/layout-examples.png
  4067. share/doc/qt5/qtdoc/images/logo.png
  4068. share/doc/qt5/qtdoc/images/mainscreen.png
  4069. share/doc/qt5/qtdoc/images/mob-idle.png
  4070. share/doc/qt5/qtdoc/images/ok.png
  4071. share/doc/qt5/qtdoc/images/open-project.png
  4072. share/doc/qt5/qtdoc/images/project-view-2.png
  4073. share/doc/qt5/qtdoc/images/project-view.png
  4074. share/doc/qt5/qtdoc/images/project-wizard.png
  4075. share/doc/qt5/qtdoc/images/qml-extending-types.gif
  4076. share/doc/qt5/qtdoc/images/qml-uses-animation.png
  4077. share/doc/qt5/qtdoc/images/qml-uses-integratingjs.png
  4078. share/doc/qt5/qtdoc/images/qml-uses-layouts-anchors.png
  4079. share/doc/qt5/qtdoc/images/qml-uses-layouts-direct.png
  4080. share/doc/qt5/qtdoc/images/qml-uses-layouts-positioners.png
  4081. share/doc/qt5/qtdoc/images/qml-uses-text.png
  4082. share/doc/qt5/qtdoc/images/qml-uses-visual-opacity.png
  4083. share/doc/qt5/qtdoc/images/qml-uses-visual-rectangles.png
  4084. share/doc/qt5/qtdoc/images/qml-uses-visual-transforms.png
  4085. share/doc/qt5/qtdoc/images/qt-codesample.png
  4086. share/doc/qt5/qtdoc/images/qt-creator-gs.png
  4087. share/doc/qt5/qtdoc/images/qt-embedded-fontfeatures.png
  4088. share/doc/qt5/qtdoc/images/qt5_everywhere_demo.jpg
  4089. share/doc/qt5/qtdoc/images/qt5_graphicaleffects.jpg
  4090. share/doc/qt5/qtdoc/images/qt5_particles.jpg
  4091. share/doc/qt5/qtdoc/images/qt5_shadereffect.jpg
  4092. share/doc/qt5/qtdoc/images/qt5_video.jpg
  4093. share/doc/qt5/qtdoc/images/qt5_widgets.jpg
  4094. share/doc/qt5/qtdoc/images/qtcreator-run.png
  4095. share/doc/qt5/qtdoc/images/qtlocation-mapviewer-demo.jpg
  4096. share/doc/qt5/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
  4097. share/doc/qt5/qtdoc/images/qtquick-demo-calqlatr.png
  4098. share/doc/qt5/qtdoc/images/qtquick-demo-clocks-small.png
  4099. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-1.png
  4100. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-2.png
  4101. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-3.jpg
  4102. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-4.jpg
  4103. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-5.jpg
  4104. share/doc/qt5/qtdoc/images/qtquick-demo-maroon-med-6.jpg
  4105. share/doc/qt5/qtdoc/images/qtquick-demo-photosurface-small.png
  4106. share/doc/qt5/qtdoc/images/qtquick-demo-photoviewer-small.png
  4107. share/doc/qt5/qtdoc/images/qtquick-demo-rssnews-small.png
  4108. share/doc/qt5/qtdoc/images/qtquick-demo-samegame-med-1.png
  4109. share/doc/qt5/qtdoc/images/qtquick-demo-samegame-med-2.png
  4110. share/doc/qt5/qtdoc/images/qtquick-demo-stocqt.png
  4111. share/doc/qt5/qtdoc/images/qtquick-demo-tweetsearch-med-1.png
  4112. share/doc/qt5/qtdoc/images/qtquick-demo-tweetsearch-med-2.png
  4113. share/doc/qt5/qtdoc/images/qtquickcontrols2-material.png
  4114. share/doc/qt5/qtdoc/images/qtsensors_accelbubble_ex.jpg
  4115. share/doc/qt5/qtdoc/images/qtwebengine_quicknanobrowser.jpg
  4116. share/doc/qt5/qtdoc/images/scalability-gridlayout.png
  4117. share/doc/qt5/qtdoc/images/select-item-to-add.png
  4118. share/doc/qt5/qtdoc/images/session.png
  4119. share/doc/qt5/qtdoc/images/sql-examples.png
  4120. share/doc/qt5/qtdoc/images/thread-examples.png
  4121. share/doc/qt5/qtdoc/images/threadsandobjects.png
  4122. share/doc/qt5/qtdoc/images/threadvisual-example.png
  4123. share/doc/qt5/qtdoc/images/tool-examples.png
  4124. share/doc/qt5/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-left.png
  4125. share/doc/qt5/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-right.png
  4126. share/doc/qt5/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-grip.png
  4127. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/arrow.png
  4128. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/background.png
  4129. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/center.png
  4130. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/clock-night.png
  4131. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/clock.png
  4132. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/hour.png
  4133. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/minute.png
  4134. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/quit.png
  4135. share/doc/qt5/qtdoc/images/used-in-examples/demos/clocks/content/second.png
  4136. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_large.png
  4137. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_outline.png
  4138. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_back.png
  4139. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_coverplate.png
  4140. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_front.png
  4141. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_coffee.png
  4142. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_foam.png
  4143. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_milk.png
  4144. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Americano.png
  4145. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Espresso.png
  4146. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Latte.png
  4147. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Macchiato.png
  4148. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/cappucino.png
  4149. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/coffee.png
  4150. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/milk.png
  4151. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/sugar.png
  4152. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/back/white.png
  4153. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/go/white.png
  4154. share/doc/qt5/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/line.png
  4155. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/background.png
  4156. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-action.png
  4157. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-idle.png
  4158. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb.png
  4159. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-help.png
  4160. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-play.png
  4161. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch-action.png
  4162. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch.png
  4163. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/cloud.png
  4164. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/currency.png
  4165. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-bomb.png
  4166. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-factory.png
  4167. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-melee.png
  4168. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-pointer.png
  4169. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-shooter.png
  4170. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog.png
  4171. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-action.png
  4172. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-idle.png
  4173. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory.png
  4174. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/grid.png
  4175. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/help.png
  4176. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/lifes.png
  4177. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-bubble.png
  4178. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-fish.png
  4179. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo.png
  4180. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-action.png
  4181. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-idle.png
  4182. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee.png
  4183. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob-idle.png
  4184. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob.png
  4185. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/points.png
  4186. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile-action.png
  4187. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile.png
  4188. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/scores.png
  4189. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-action.png
  4190. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-idle.png
  4191. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter.png
  4192. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/sunlight.png
  4193. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-1.png
  4194. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-2.png
  4195. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-3.png
  4196. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-blank.png
  4197. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-gameover.png
  4198. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-go.png
  4199. share/doc/qt5/qtdoc/images/used-in-examples/demos/maroon/content/gfx/wave.png
  4200. share/doc/qt5/qtdoc/images/used-in-examples/demos/photosurface/resources/folder.png
  4201. share/doc/qt5/qtdoc/images/used-in-examples/demos/photosurface/resources/icon.png
  4202. share/doc/qt5/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/box-shadow.png
  4203. share/doc/qt5/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/busy.png
  4204. share/doc/qt5/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/cardboard.png
  4205. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Asia.jpg
  4206. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Business.jpg
  4207. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Entertainment.jpg
  4208. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Europe.jpg
  4209. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Health.jpg
  4210. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Politics.jpg
  4211. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Science.jpg
  4212. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Sports.jpg
  4213. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/Technology.jpg
  4214. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/TopStories.jpg
  4215. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/USNational.jpg
  4216. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/World.jpg
  4217. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/btn_close.png
  4218. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/busy.png
  4219. share/doc/qt5/qtdoc/images/used-in-examples/demos/rssnews/content/images/scrollbar.png
  4220. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background-puzzle.png
  4221. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background.png
  4222. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bar.png
  4223. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue-puzzle.png
  4224. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue.png
  4225. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-highscore.png
  4226. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-puzzle.png
  4227. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-1.png
  4228. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-2.png
  4229. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-3.png
  4230. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-4.png
  4231. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-new.png
  4232. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-menu.png
  4233. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-puzzle-next.png
  4234. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-quit.png
  4235. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green-puzzle.png
  4236. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green.png
  4237. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-fail.png
  4238. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-ok.png
  4239. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-time.png
  4240. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-a.png
  4241. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-e.png
  4242. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-g.png
  4243. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-m.png
  4244. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-s.png
  4245. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo.png
  4246. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-brick.png
  4247. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-paint.png
  4248. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-smoke.png
  4249. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red-puzzle.png
  4250. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red.png
  4251. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore-new.png
  4252. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore.png
  4253. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-no-winner.png
  4254. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-go.png
  4255. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-won.png
  4256. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1.png
  4257. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-go.png
  4258. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-won.png
  4259. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2.png
  4260. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow-puzzle.png
  4261. share/doc/qt5/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow.png
  4262. share/doc/qt5/qtdoc/images/used-in-examples/demos/stocqt/content/images/icon-left-arrow.png
  4263. share/doc/qt5/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel-touch.png
  4264. share/doc/qt5/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel.png
  4265. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/anonymous.png
  4266. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/bird-anim-sprites.png
  4267. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-clear.png
  4268. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-loading.png
  4269. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-refresh.png
  4270. share/doc/qt5/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-search.png
  4271. share/doc/qt5/qtdoc/images/xml-examples.png
  4272. share/doc/qt5/qtdoc/index.html
  4273. share/doc/qt5/qtdoc/integrity-building-monolith.html
  4274. share/doc/qt5/qtdoc/integrity-building-qt-for-imx6quad-board.html
  4275. share/doc/qt5/qtdoc/integrity-building-u-boot-image.html
  4276. share/doc/qt5/qtdoc/integrity-creating-bootable-sd-card.html
  4277. share/doc/qt5/qtdoc/integrity-installing-dependencies.html
  4278. share/doc/qt5/qtdoc/integrity-monolith-project-tutorial.html
  4279. share/doc/qt5/qtdoc/integrity-preparing-bsp-for-imx6quad-board.html
  4280. share/doc/qt5/qtdoc/integrity-preparing-u-boot.html
  4281. share/doc/qt5/qtdoc/integrity.html
  4282. share/doc/qt5/qtdoc/internationalization.html
  4283. share/doc/qt5/qtdoc/ios-building-from-source.html
  4284. share/doc/qt5/qtdoc/ios-platform-notes.html
  4285. share/doc/qt5/qtdoc/ios.html
  4286. share/doc/qt5/qtdoc/ipc.html
  4287. share/doc/qt5/qtdoc/known-issues.html
  4288. share/doc/qt5/qtdoc/lgpl.html
  4289. share/doc/qt5/qtdoc/license-changes.html
  4290. share/doc/qt5/qtdoc/licenses-used-in-qt.html
  4291. share/doc/qt5/qtdoc/licensing.html
  4292. share/doc/qt5/qtdoc/linux-building.html
  4293. share/doc/qt5/qtdoc/linux-deployment.html
  4294. share/doc/qt5/qtdoc/linux-issues.html
  4295. share/doc/qt5/qtdoc/linux-requirements.html
  4296. share/doc/qt5/qtdoc/linux.html
  4297. share/doc/qt5/qtdoc/macos-building.html
  4298. share/doc/qt5/qtdoc/macos-deployment.html
  4299. share/doc/qt5/qtdoc/macos-issues.html
  4300. share/doc/qt5/qtdoc/macos.html
  4301. share/doc/qt5/qtdoc/mobiledevelopment.html
  4302. share/doc/qt5/qtdoc/moc.html
  4303. share/doc/qt5/qtdoc/modules-cpp.html
  4304. share/doc/qt5/qtdoc/modules-qml.html
  4305. share/doc/qt5/qtdoc/modules.html
  4306. share/doc/qt5/qtdoc/namespaces.html
  4307. share/doc/qt5/qtdoc/newclasses51.html
  4308. share/doc/qt5/qtdoc/newclasses510.html
  4309. share/doc/qt5/qtdoc/newclasses511.html
  4310. share/doc/qt5/qtdoc/newclasses512.html
  4311. share/doc/qt5/qtdoc/newclasses52.html
  4312. share/doc/qt5/qtdoc/newclasses53.html
  4313. share/doc/qt5/qtdoc/newclasses54.html
  4314. share/doc/qt5/qtdoc/newclasses55.html
  4315. share/doc/qt5/qtdoc/newclasses56.html
  4316. share/doc/qt5/qtdoc/newclasses57.html
  4317. share/doc/qt5/qtdoc/newclasses58.html
  4318. share/doc/qt5/qtdoc/newclasses59.html
  4319. share/doc/qt5/qtdoc/obsoleteclasses.html
  4320. share/doc/qt5/qtdoc/obsoleteqmltypes.html
  4321. share/doc/qt5/qtdoc/opensourcelicense.html
  4322. share/doc/qt5/qtdoc/overviews-main.html
  4323. share/doc/qt5/qtdoc/overviews.html
  4324. share/doc/qt5/qtdoc/plugins-howto.html
  4325. share/doc/qt5/qtdoc/porting-to-android.html
  4326. share/doc/qt5/qtdoc/porting-to-ios.html
  4327. share/doc/qt5/qtdoc/portingcppapp.html
  4328. share/doc/qt5/qtdoc/portingguide.html
  4329. share/doc/qt5/qtdoc/portingqmlapp.html
  4330. share/doc/qt5/qtdoc/qml-codingconventions.html
  4331. share/doc/qt5/qtdoc/qml-glossary.html
  4332. share/doc/qt5/qtdoc/qmlapplications.html
  4333. share/doc/qt5/qtdoc/qmlbasictypes.html
  4334. share/doc/qt5/qtdoc/qmlfirststeps.html
  4335. share/doc/qt5/qtdoc/qmltypes.html
  4336. share/doc/qt5/qtdoc/qnx.html
  4337. share/doc/qt5/qtdoc/qpa.html
  4338. share/doc/qt5/qtdoc/qt-activex.html
  4339. share/doc/qt5/qtdoc/qt-attribution-cmake-macros.html
  4340. share/doc/qt5/qtdoc/qt-attribution-llvm.html
  4341. share/doc/qt5/qtdoc/qt-attribution-llvmpipe.html
  4342. share/doc/qt5/qtdoc/qt-conf.html
  4343. share/doc/qt5/qtdoc/qt-embedded-fonts.html
  4344. share/doc/qt5/qtdoc/qt-embedded-kmap2qmap.html
  4345. share/doc/qt5/qtdoc/qt-embedded-makeqpf.html
  4346. share/doc/qt5/qtdoc/qt-gui-concepts.html
  4347. share/doc/qt5/qtdoc/qt5-intro.html
  4348. share/doc/qt5/qtdoc/qtconcurrent-mtexamples.html
  4349. share/doc/qt5/qtdoc/qtconcurrentexamples.html
  4350. share/doc/qt5/qtdoc/qtdoc-attribution-coffeeexample-titillium.html
  4351. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-calqlatr-pro.html
  4352. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-calqlatr-qml.html
  4353. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-calqlatr-qmlproject.html
  4354. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-calqlatr-qrc.html
  4355. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-content-button-qml.html
  4356. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-content-calculator-js.html
  4357. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-content-display-qml.html
  4358. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-content-numberpad-qml.html
  4359. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-example.html
  4360. share/doc/qt5/qtdoc/qtdoc-demos-calqlatr-main-cpp.html
  4361. share/doc/qt5/qtdoc/qtdoc-demos-clocks-clocks-pro.html
  4362. share/doc/qt5/qtdoc/qtdoc-demos-clocks-clocks-qml.html
  4363. share/doc/qt5/qtdoc/qtdoc-demos-clocks-clocks-qmlproject.html
  4364. share/doc/qt5/qtdoc/qtdoc-demos-clocks-clocks-qrc.html
  4365. share/doc/qt5/qtdoc/qtdoc-demos-clocks-content-clock-qml.html
  4366. share/doc/qt5/qtdoc/qtdoc-demos-clocks-example.html
  4367. share/doc/qt5/qtdoc/qtdoc-demos-clocks-main-cpp.html
  4368. share/doc/qt5/qtdoc/qtdoc-demos-coffee-applicationflow-qml.html
  4369. share/doc/qt5/qtdoc/qtdoc-demos-coffee-applicationflowform-ui-qml.html
  4370. share/doc/qt5/qtdoc/qtdoc-demos-coffee-brewing-qml.html
  4371. share/doc/qt5/qtdoc/qtdoc-demos-coffee-brewingform-ui-qml.html
  4372. share/doc/qt5/qtdoc/qtdoc-demos-coffee-choosingcoffee-ui-qml.html
  4373. share/doc/qt5/qtdoc/qtdoc-demos-coffee-coffee-pro.html
  4374. share/doc/qt5/qtdoc/qtdoc-demos-coffee-coffeebutton-qml.html
  4375. share/doc/qt5/qtdoc/qtdoc-demos-coffee-cup-qml.html
  4376. share/doc/qt5/qtdoc/qtdoc-demos-coffee-cupform-ui-qml.html
  4377. share/doc/qt5/qtdoc/qtdoc-demos-coffee-emptycup-qml.html
  4378. share/doc/qt5/qtdoc/qtdoc-demos-coffee-emptycupform-ui-qml.html
  4379. share/doc/qt5/qtdoc/qtdoc-demos-coffee-example.html
  4380. share/doc/qt5/qtdoc/qtdoc-demos-coffee-imports-coffee-constants-qml.html
  4381. share/doc/qt5/qtdoc/qtdoc-demos-coffee-imports-coffee-qmldir.html
  4382. share/doc/qt5/qtdoc/qtdoc-demos-coffee-main-cpp.html
  4383. share/doc/qt5/qtdoc/qtdoc-demos-coffee-main-qml.html
  4384. share/doc/qt5/qtdoc/qtdoc-demos-coffee-navigationbutton-ui-qml.html
  4385. share/doc/qt5/qtdoc/qtdoc-demos-coffee-qml-qrc.html
  4386. share/doc/qt5/qtdoc/qtdoc-demos-coffee-sidebar-qml.html
  4387. share/doc/qt5/qtdoc/qtdoc-demos-coffee-sidebarform-ui-qml.html
  4388. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-buildbutton-qml.html
  4389. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-gamecanvas-qml.html
  4390. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-gameoverscreen-qml.html
  4391. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-infobar-qml.html
  4392. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-logic-js.html
  4393. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-mobs-mobbase-qml.html
  4394. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-newgamescreen-qml.html
  4395. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-soundeffect-qml.html
  4396. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-towers-bomb-qml.html
  4397. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-towers-factory-qml.html
  4398. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-towers-melee-qml.html
  4399. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-towers-ranged-qml.html
  4400. share/doc/qt5/qtdoc/qtdoc-demos-maroon-content-towers-towerbase-qml.html
  4401. share/doc/qt5/qtdoc/qtdoc-demos-maroon-example.html
  4402. share/doc/qt5/qtdoc/qtdoc-demos-maroon-main-cpp.html
  4403. share/doc/qt5/qtdoc/qtdoc-demos-maroon-maroon-pro.html
  4404. share/doc/qt5/qtdoc/qtdoc-demos-maroon-maroon-qml.html
  4405. share/doc/qt5/qtdoc/qtdoc-demos-maroon-maroon-qmlproject.html
  4406. share/doc/qt5/qtdoc/qtdoc-demos-maroon-maroon-qrc.html
  4407. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-example.html
  4408. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-main-cpp.html
  4409. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-photosurface-pro.html
  4410. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-photosurface-qml.html
  4411. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-photosurface-qmlproject.html
  4412. share/doc/qt5/qtdoc/qtdoc-demos-photosurface-photosurface-qrc.html
  4413. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-example.html
  4414. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-main-cpp.html
  4415. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-main-qml.html
  4416. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewer-pro.html
  4417. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-albumdelegate-qml.html
  4418. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-busyindicator-qml.html
  4419. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-button-qml.html
  4420. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-editablebutton-qml.html
  4421. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-photodelegate-qml.html
  4422. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-progressbar-qml.html
  4423. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-rssmodel-qml.html
  4424. share/doc/qt5/qtdoc/qtdoc-demos-photoviewer-photoviewercore-tag-qml.html
  4425. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-content-busyindicator-qml.html
  4426. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-content-categorydelegate-qml.html
  4427. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-content-newsdelegate-qml.html
  4428. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-content-rssfeeds-qml.html
  4429. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-content-scrollbar-qml.html
  4430. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-example.html
  4431. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-main-cpp.html
  4432. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-rssnews-pro.html
  4433. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-rssnews-qml.html
  4434. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-rssnews-qmlproject.html
  4435. share/doc/qt5/qtdoc/qtdoc-demos-rssnews-rssnews-qrc.html
  4436. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-block-qml.html
  4437. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-blockemitter-qml.html
  4438. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-button-qml.html
  4439. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-gamearea-qml.html
  4440. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level0-qml.html
  4441. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level1-qml.html
  4442. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level2-qml.html
  4443. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level3-qml.html
  4444. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level4-qml.html
  4445. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level5-qml.html
  4446. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level6-qml.html
  4447. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level7-qml.html
  4448. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level8-qml.html
  4449. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-level9-qml.html
  4450. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-levels-templatebase-qml.html
  4451. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-logoanimation-qml.html
  4452. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-menuemitter-qml.html
  4453. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-paintemitter-qml.html
  4454. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-primarypack-qml.html
  4455. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-puzzleblock-qml.html
  4456. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-qmldir.html
  4457. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-samegame-js.html
  4458. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-samegametext-qml.html
  4459. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-settings-qml.html
  4460. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-simpleblock-qml.html
  4461. share/doc/qt5/qtdoc/qtdoc-demos-samegame-content-smoketext-qml.html
  4462. share/doc/qt5/qtdoc/qtdoc-demos-samegame-example.html
  4463. share/doc/qt5/qtdoc/qtdoc-demos-samegame-main-cpp.html
  4464. share/doc/qt5/qtdoc/qtdoc-demos-samegame-samegame-pro.html
  4465. share/doc/qt5/qtdoc/qtdoc-demos-samegame-samegame-qml.html
  4466. share/doc/qt5/qtdoc/qtdoc-demos-samegame-samegame-qmlproject.html
  4467. share/doc/qt5/qtdoc/qtdoc-demos-samegame-samegame-qrc.html
  4468. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-banner-qml.html
  4469. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-button-qml.html
  4470. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-checkbox-qml.html
  4471. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-qmldir.html
  4472. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-settings-qml.html
  4473. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stockchart-qml.html
  4474. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stockinfo-qml.html
  4475. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stocklistdelegate-qml.html
  4476. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stocklistmodel-qml.html
  4477. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stocklistview-qml.html
  4478. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stockmodel-qml.html
  4479. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stocksettingspanel-qml.html
  4480. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-stockview-qml.html
  4481. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-content-windows-settings-qml.html
  4482. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-example.html
  4483. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-main-cpp.html
  4484. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-stocqt-pro.html
  4485. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-stocqt-qml.html
  4486. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-stocqt-qmlproject.html
  4487. share/doc/qt5/qtdoc/qtdoc-demos-stocqt-stocqt-qrc.html
  4488. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-flipbar-qml.html
  4489. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-lineinput-qml.html
  4490. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-listfooter-qml.html
  4491. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-listheader-qml.html
  4492. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-searchdelegate-qml.html
  4493. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-tweetdelegate-qml.html
  4494. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-content-tweetsmodel-qml.html
  4495. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-example.html
  4496. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-main-cpp.html
  4497. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-pro.html
  4498. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qml.html
  4499. share/doc/qt5/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qmlproject.html
  4500. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-alarmdelegate-qml.html
  4501. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-alarmdialog-qml.html
  4502. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-alarmmodel-qml.html
  4503. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-alarms-pro.html
  4504. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-example.html
  4505. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-main-cpp.html
  4506. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-main-qml.html
  4507. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-qml-qrc.html
  4508. share/doc/qt5/qtdoc/qtdoc-tutorials-alarms-tumblerdelegate-qml.html
  4509. share/doc/qt5/qtdoc/qtdoc.index
  4510. share/doc/qt5/qtdoc/qtdoc.qhp
  4511. share/doc/qt5/qtdoc/qtdoc.qhp.sha1
  4512. share/doc/qt5/qtdoc/qtexamples.html
  4513. share/doc/qt5/qtdoc/qtexamplesandtutorials.html
  4514. share/doc/qt5/qtdoc/qtmain.html
  4515. share/doc/qt5/qtdoc/qtmodules.html
  4516. share/doc/qt5/qtdoc/qtopenglextensions.html
  4517. share/doc/qt5/qtdoc/qtquick-debugging.html
  4518. share/doc/qt5/qtdoc/qtquick-deployment.html
  4519. share/doc/qt5/qtdoc/qtquick-internationalization.html
  4520. share/doc/qt5/qtdoc/qtquick-performance.html
  4521. share/doc/qt5/qtdoc/qtquick-porting-qt5.html
  4522. share/doc/qt5/qtdoc/qtquick-qmlscene.html
  4523. share/doc/qt5/qtdoc/qtquick-usecase-animations.html
  4524. share/doc/qt5/qtdoc/qtquick-usecase-integratingjs.html
  4525. share/doc/qt5/qtdoc/qtquick-usecase-layouts.html
  4526. share/doc/qt5/qtdoc/qtquick-usecase-styling.html
  4527. share/doc/qt5/qtdoc/qtquick-usecase-text.html
  4528. share/doc/qt5/qtdoc/qtquick-usecase-userinput.html
  4529. share/doc/qt5/qtdoc/qtquick-usecase-visual.html
  4530. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-action.html
  4531. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-logic.html
  4532. share/doc/qt5/qtdoc/qtquickcontrols-texteditor-ui.html
  4533. share/doc/qt5/qtdoc/qtquickcontrols-texteditor.html
  4534. share/doc/qt5/qtdoc/qundo.html
  4535. share/doc/qt5/qtdoc/rcc.html
  4536. share/doc/qt5/qtdoc/reference-overview.html
  4537. share/doc/qt5/qtdoc/restoring-geometry.html
  4538. share/doc/qt5/qtdoc/scalability.html
  4539. share/doc/qt5/qtdoc/session.html
  4540. share/doc/qt5/qtdoc/sharedlibrary.html
  4541. share/doc/qt5/qtdoc/signalsandslots-syntaxes.html
  4542. share/doc/qt5/qtdoc/sourcebreaks.html
  4543. share/doc/qt5/qtdoc/sql-examples.html
  4544. share/doc/qt5/qtdoc/string-processing.html
  4545. share/doc/qt5/qtdoc/style/offline-simple.css
  4546. share/doc/qt5/qtdoc/style/offline.css
  4547. share/doc/qt5/qtdoc/style/qt5-sidebar.html
  4548. share/doc/qt5/qtdoc/supported-platforms.html
  4549. share/doc/qt5/qtdoc/testing-and-debugging.html
  4550. share/doc/qt5/qtdoc/third-party-libraries.html
  4551. share/doc/qt5/qtdoc/thread-basics.html
  4552. share/doc/qt5/qtdoc/thread.html
  4553. share/doc/qt5/qtdoc/threads-modules.html
  4554. share/doc/qt5/qtdoc/threads-qobject.html
  4555. share/doc/qt5/qtdoc/threads-reentrancy.html
  4556. share/doc/qt5/qtdoc/threads-synchronizing.html
  4557. share/doc/qt5/qtdoc/threads-technologies.html
  4558. share/doc/qt5/qtdoc/threads.html
  4559. share/doc/qt5/qtdoc/topics-app-development.html
  4560. share/doc/qt5/qtdoc/topics-core.html
  4561. share/doc/qt5/qtdoc/topics-data-storage.html
  4562. share/doc/qt5/qtdoc/topics-graphics.html
  4563. share/doc/qt5/qtdoc/topics-network-connectivity.html
  4564. share/doc/qt5/qtdoc/topics-scripting.html
  4565. share/doc/qt5/qtdoc/topics-ui.html
  4566. share/doc/qt5/qtdoc/topics-web-content.html
  4567. share/doc/qt5/qtdoc/touchinputexamples.html
  4568. share/doc/qt5/qtdoc/trademarks.html
  4569. share/doc/qt5/qtdoc/uic.html
  4570. share/doc/qt5/qtdoc/unicode.html
  4571. share/doc/qt5/qtdoc/unix-signals.html
  4572. share/doc/qt5/qtdoc/vxworks.html
  4573. share/doc/qt5/qtdoc/wasm.html
  4574. share/doc/qt5/qtdoc/webgl.html
  4575. share/doc/qt5/qtdoc/whatsnew50.html
  4576. share/doc/qt5/qtdoc/whatsnew51.html
  4577. share/doc/qt5/qtdoc/whatsnew510.html
  4578. share/doc/qt5/qtdoc/whatsnew511.html
  4579. share/doc/qt5/qtdoc/whatsnew512.html
  4580. share/doc/qt5/qtdoc/whatsnew52.html
  4581. share/doc/qt5/qtdoc/whatsnew53.html
  4582. share/doc/qt5/qtdoc/whatsnew54.html
  4583. share/doc/qt5/qtdoc/whatsnew55.html
  4584. share/doc/qt5/qtdoc/whatsnew56.html
  4585. share/doc/qt5/qtdoc/whatsnew57.html
  4586. share/doc/qt5/qtdoc/whatsnew58.html
  4587. share/doc/qt5/qtdoc/whatsnew59.html
  4588. share/doc/qt5/qtdoc/why-moc.html
  4589. share/doc/qt5/qtdoc/windows-building.html
  4590. share/doc/qt5/qtdoc/windows-deployment.html
  4591. share/doc/qt5/qtdoc/windows-issues.html
  4592. share/doc/qt5/qtdoc/windows-requirements.html
  4593. share/doc/qt5/qtdoc/windows.html
  4594. share/doc/qt5/qtdoc/winrt-support.html
  4595. share/doc/qt5/qtdoc/xml-examples.html
  4596. share/doc/qt5/qtgamepad.qch
  4597. share/doc/qt5/qtgamepad/examples-manifest.xml
  4598. share/doc/qt5/qtgamepad/images/arrow_bc.png
  4599. share/doc/qt5/qtgamepad/images/bgrContent.png
  4600. share/doc/qt5/qtgamepad/images/btn_next.png
  4601. share/doc/qt5/qtgamepad/images/btn_prev.png
  4602. share/doc/qt5/qtgamepad/images/bullet_dn.png
  4603. share/doc/qt5/qtgamepad/images/bullet_sq.png
  4604. share/doc/qt5/qtgamepad/images/configuregamepadbuttons-example.png
  4605. share/doc/qt5/qtgamepad/images/home.png
  4606. share/doc/qt5/qtgamepad/images/ico_note.png
  4607. share/doc/qt5/qtgamepad/images/ico_note_attention.png
  4608. share/doc/qt5/qtgamepad/images/ico_out.png
  4609. share/doc/qt5/qtgamepad/images/keynavigationgamepad-example.png
  4610. share/doc/qt5/qtgamepad/images/logo.png
  4611. share/doc/qt5/qtgamepad/images/qtquickgamepad-example.png
  4612. share/doc/qt5/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation64.png
  4613. share/doc/qt5/qtgamepad/images/used-in-examples/keyNavigation/keyNavigation80.png
  4614. share/doc/qt5/qtgamepad/images/used-in-examples/mouseItem/mouseItem64.png
  4615. share/doc/qt5/qtgamepad/images/used-in-examples/mouseItem/mouseItem80.png
  4616. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerBack.png
  4617. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonA.png
  4618. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonB.png
  4619. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonGuide.png
  4620. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonX.png
  4621. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerButtonY.png
  4622. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerDPad.png
  4623. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftShoulder.png
  4624. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftThumbstick.png
  4625. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerLeftTrigger.png
  4626. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightShoulder.png
  4627. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightThumbstick.png
  4628. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerRightTrigger.png
  4629. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/qml/xboxControllerStart.png
  4630. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad64.png
  4631. share/doc/qt5/qtgamepad/images/used-in-examples/quickGamepad/quickGamepad80.png
  4632. share/doc/qt5/qtgamepad/qgamepad-members.html
  4633. share/doc/qt5/qtgamepad/qgamepad-obsolete.html
  4634. share/doc/qt5/qtgamepad/qgamepad.html
  4635. share/doc/qt5/qtgamepad/qgamepadkeynavigation-members.html
  4636. share/doc/qt5/qtgamepad/qgamepadkeynavigation-obsolete.html
  4637. share/doc/qt5/qtgamepad/qgamepadkeynavigation.html
  4638. share/doc/qt5/qtgamepad/qgamepadmanager-members.html
  4639. share/doc/qt5/qtgamepad/qgamepadmanager-obsolete.html
  4640. share/doc/qt5/qtgamepad/qgamepadmanager.html
  4641. share/doc/qt5/qtgamepad/qml-qtgamepad-gamepad-members.html
  4642. share/doc/qt5/qtgamepad/qml-qtgamepad-gamepad.html
  4643. share/doc/qt5/qtgamepad/qml-qtgamepad-gamepadmanager-members.html
  4644. share/doc/qt5/qtgamepad/qml-qtgamepad-gamepadmanager.html
  4645. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-android-androidmanifest-xml.html
  4646. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-configurebuttons-pro.html
  4647. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-example.html
  4648. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-cpp.html
  4649. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-main-qml.html
  4650. share/doc/qt5/qtgamepad/qtgamepad-configurebuttons-qml-qrc.html
  4651. share/doc/qt5/qtgamepad/qtgamepad-examples.html
  4652. share/doc/qt5/qtgamepad/qtgamepad-index.html
  4653. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-example.html
  4654. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-keynavigation-pro.html
  4655. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-main-cpp.html
  4656. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-main-qml.html
  4657. share/doc/qt5/qtgamepad/qtgamepad-keynavigation-qml-qrc.html
  4658. share/doc/qt5/qtgamepad/qtgamepad-module.html
  4659. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-example.html
  4660. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-main-cpp.html
  4661. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-mouseitem-pro.html
  4662. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-main-qml.html
  4663. share/doc/qt5/qtgamepad/qtgamepad-mouseitem-qml-qrc.html
  4664. share/doc/qt5/qtgamepad/qtgamepad-qmlmodule.html
  4665. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-example.html
  4666. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-main-cpp.html
  4667. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-buttonimage-qml.html
  4668. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-dpad-qml.html
  4669. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-joystickviewer-qml.html
  4670. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-leftthumbstick-qml.html
  4671. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-main-qml.html
  4672. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-qrc.html
  4673. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-qml-rightthumbstick-qml.html
  4674. share/doc/qt5/qtgamepad/qtgamepad-quickgamepad-quickgamepad-pro.html
  4675. share/doc/qt5/qtgamepad/qtgamepad-simple-android-androidmanifest-xml.html
  4676. share/doc/qt5/qtgamepad/qtgamepad-simple-example.html
  4677. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-cpp.html
  4678. share/doc/qt5/qtgamepad/qtgamepad-simple-gamepadmonitor-h.html
  4679. share/doc/qt5/qtgamepad/qtgamepad-simple-main-cpp.html
  4680. share/doc/qt5/qtgamepad/qtgamepad-simple-simple-pro.html
  4681. share/doc/qt5/qtgamepad/qtgamepad.index
  4682. share/doc/qt5/qtgamepad/qtgamepad.qhp
  4683. share/doc/qt5/qtgamepad/qtgamepad.qhp.sha1
  4684. share/doc/qt5/qtgamepad/style/offline-simple.css
  4685. share/doc/qt5/qtgamepad/style/offline.css
  4686. share/doc/qt5/qtgraphicaleffects.qch
  4687. share/doc/qt5/qtgraphicaleffects/graphicaleffects.html
  4688. share/doc/qt5/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
  4689. share/doc/qt5/qtgraphicaleffects/images/Blend_mode1.png
  4690. share/doc/qt5/qtgraphicaleffects/images/Blend_mode10.png
  4691. share/doc/qt5/qtgraphicaleffects/images/Blend_mode11.png
  4692. share/doc/qt5/qtgraphicaleffects/images/Blend_mode12.png
  4693. share/doc/qt5/qtgraphicaleffects/images/Blend_mode13.png
  4694. share/doc/qt5/qtgraphicaleffects/images/Blend_mode14.png
  4695. share/doc/qt5/qtgraphicaleffects/images/Blend_mode15.png
  4696. share/doc/qt5/qtgraphicaleffects/images/Blend_mode16.png
  4697. share/doc/qt5/qtgraphicaleffects/images/Blend_mode17.png
  4698. share/doc/qt5/qtgraphicaleffects/images/Blend_mode18.png
  4699. share/doc/qt5/qtgraphicaleffects/images/Blend_mode19.png
  4700. share/doc/qt5/qtgraphicaleffects/images/Blend_mode2.png
  4701. share/doc/qt5/qtgraphicaleffects/images/Blend_mode20.png
  4702. share/doc/qt5/qtgraphicaleffects/images/Blend_mode21.png
  4703. share/doc/qt5/qtgraphicaleffects/images/Blend_mode22.png
  4704. share/doc/qt5/qtgraphicaleffects/images/Blend_mode3.png
  4705. share/doc/qt5/qtgraphicaleffects/images/Blend_mode4.png
  4706. share/doc/qt5/qtgraphicaleffects/images/Blend_mode5.png
  4707. share/doc/qt5/qtgraphicaleffects/images/Blend_mode6.png
  4708. share/doc/qt5/qtgraphicaleffects/images/Blend_mode7.png
  4709. share/doc/qt5/qtgraphicaleffects/images/Blend_mode8.png
  4710. share/doc/qt5/qtgraphicaleffects/images/Blend_mode9.png
  4711. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
  4712. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
  4713. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
  4714. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_bug.png
  4715. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
  4716. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
  4717. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
  4718. share/doc/qt5/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
  4719. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_butterfly.png
  4720. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color1.png
  4721. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color2.png
  4722. share/doc/qt5/qtgraphicaleffects/images/ColorOverlay_color3.png
  4723. share/doc/qt5/qtgraphicaleffects/images/Colorize_bug.png
  4724. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue1.png
  4725. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue2.png
  4726. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue3.png
  4727. share/doc/qt5/qtgraphicaleffects/images/Colorize_hue_scale.png
  4728. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness1.png
  4729. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness2.png
  4730. share/doc/qt5/qtgraphicaleffects/images/Colorize_lightness3.png
  4731. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation1.png
  4732. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation2.png
  4733. share/doc/qt5/qtgraphicaleffects/images/Colorize_saturation3.png
  4734. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient.png
  4735. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle1.png
  4736. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle2.png
  4737. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_angle3.png
  4738. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient1.png
  4739. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient2.png
  4740. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_gradient3.png
  4741. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
  4742. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
  4743. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
  4744. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
  4745. share/doc/qt5/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
  4746. share/doc/qt5/qtgraphicaleffects/images/Desaturate_bug.png
  4747. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation1.png
  4748. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation2.png
  4749. share/doc/qt5/qtgraphicaleffects/images/Desaturate_desaturation3.png
  4750. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle1.png
  4751. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle2.png
  4752. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_angle3.png
  4753. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_bug.png
  4754. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length1.png
  4755. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length2.png
  4756. share/doc/qt5/qtgraphicaleffects/images/DirectionalBlur_length3.png
  4757. share/doc/qt5/qtgraphicaleffects/images/Displace_bug.png
  4758. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement1.png
  4759. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement2.png
  4760. share/doc/qt5/qtgraphicaleffects/images/Displace_displacement3.png
  4761. share/doc/qt5/qtgraphicaleffects/images/Displace_map.png
  4762. share/doc/qt5/qtgraphicaleffects/images/DropShadow-transparentBorder.png
  4763. share/doc/qt5/qtgraphicaleffects/images/DropShadow_butterfly.png
  4764. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color1.png
  4765. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color2.png
  4766. share/doc/qt5/qtgraphicaleffects/images/DropShadow_color3.png
  4767. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
  4768. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
  4769. share/doc/qt5/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
  4770. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius1.png
  4771. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius2.png
  4772. share/doc/qt5/qtgraphicaleffects/images/DropShadow_radius3.png
  4773. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread1.png
  4774. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread2.png
  4775. share/doc/qt5/qtgraphicaleffects/images/DropShadow_spread3.png
  4776. share/doc/qt5/qtgraphicaleffects/images/FastBlur_bug.png
  4777. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius1.png
  4778. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius2.png
  4779. share/doc/qt5/qtgraphicaleffects/images/FastBlur_radius3.png
  4780. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
  4781. share/doc/qt5/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
  4782. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_bug.png
  4783. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1.png
  4784. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
  4785. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2.png
  4786. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
  4787. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3.png
  4788. share/doc/qt5/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
  4789. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_bug.png
  4790. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation1.png
  4791. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation2.png
  4792. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation3.png
  4793. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
  4794. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius1.png
  4795. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius2.png
  4796. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_radius3.png
  4797. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
  4798. share/doc/qt5/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
  4799. share/doc/qt5/qtgraphicaleffects/images/Glow-transparentBorder.png
  4800. share/doc/qt5/qtgraphicaleffects/images/Glow_butterfly.png
  4801. share/doc/qt5/qtgraphicaleffects/images/Glow_color1.png
  4802. share/doc/qt5/qtgraphicaleffects/images/Glow_color2.png
  4803. share/doc/qt5/qtgraphicaleffects/images/Glow_color3.png
  4804. share/doc/qt5/qtgraphicaleffects/images/Glow_radius1.png
  4805. share/doc/qt5/qtgraphicaleffects/images/Glow_radius2.png
  4806. share/doc/qt5/qtgraphicaleffects/images/Glow_radius3.png
  4807. share/doc/qt5/qtgraphicaleffects/images/Glow_spread1.png
  4808. share/doc/qt5/qtgraphicaleffects/images/Glow_spread2.png
  4809. share/doc/qt5/qtgraphicaleffects/images/Glow_spread3.png
  4810. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_bug.png
  4811. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue1.png
  4812. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue2.png
  4813. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_hue3.png
  4814. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness1.png
  4815. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness2.png
  4816. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_lightness3.png
  4817. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation1.png
  4818. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation2.png
  4819. share/doc/qt5/qtgraphicaleffects/images/HueSaturation_saturation3.png
  4820. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_butterfly.png
  4821. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color1.png
  4822. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color2.png
  4823. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_color3.png
  4824. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast1.png
  4825. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_fast2.png
  4826. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
  4827. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
  4828. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
  4829. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius1.png
  4830. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius2.png
  4831. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_radius3.png
  4832. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread1.png
  4833. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread2.png
  4834. share/doc/qt5/qtgraphicaleffects/images/InnerShadow_spread3.png
  4835. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_butterfly.png
  4836. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_default_curve.png
  4837. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma1.png
  4838. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2.png
  4839. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
  4840. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3.png
  4841. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
  4842. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
  4843. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
  4844. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
  4845. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
  4846. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
  4847. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
  4848. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
  4849. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
  4850. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
  4851. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
  4852. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
  4853. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
  4854. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
  4855. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
  4856. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
  4857. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
  4858. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
  4859. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
  4860. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
  4861. share/doc/qt5/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
  4862. share/doc/qt5/qtgraphicaleffects/images/LinearGradient.png
  4863. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end1.png
  4864. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end2.png
  4865. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_end3.png
  4866. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient1.png
  4867. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient2.png
  4868. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_gradient3.png
  4869. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource1.png
  4870. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_maskSource2.png
  4871. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start1.png
  4872. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start2.png
  4873. share/doc/qt5/qtgraphicaleffects/images/LinearGradient_start3.png
  4874. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_bug.png
  4875. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_mask.png
  4876. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius1.png
  4877. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius2.png
  4878. share/doc/qt5/qtgraphicaleffects/images/MaskedBlur_radius3.png
  4879. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_bug.png
  4880. share/doc/qt5/qtgraphicaleffects/images/OpacityMask_mask.png
  4881. share/doc/qt5/qtgraphicaleffects/images/Original_bug.png
  4882. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly.png
  4883. share/doc/qt5/qtgraphicaleffects/images/Original_butterfly_black.png
  4884. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle1.png
  4885. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle2.png
  4886. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_angle3.png
  4887. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_bug.png
  4888. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
  4889. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
  4890. share/doc/qt5/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
  4891. share/doc/qt5/qtgraphicaleffects/images/RadialGradient.png
  4892. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle1.png
  4893. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle2.png
  4894. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_angle3.png
  4895. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient1.png
  4896. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient2.png
  4897. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_gradient3.png
  4898. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
  4899. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
  4900. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
  4901. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
  4902. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
  4903. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource1.png
  4904. share/doc/qt5/qtgraphicaleffects/images/RadialGradient_maskSource2.png
  4905. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_applied.png
  4906. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color1.png
  4907. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color2.png
  4908. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_color3.png
  4909. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
  4910. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
  4911. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
  4912. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
  4913. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
  4914. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
  4915. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread1.png
  4916. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread2.png
  4917. share/doc/qt5/qtgraphicaleffects/images/RectangularGlow_spread3.png
  4918. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_bug.png
  4919. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops1.png
  4920. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops2.png
  4921. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_loops3.png
  4922. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius1.png
  4923. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius2.png
  4924. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_radius3.png
  4925. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
  4926. share/doc/qt5/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
  4927. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_bug.png
  4928. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_mask.png
  4929. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread1.png
  4930. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread2.png
  4931. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_spread3.png
  4932. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold1.png
  4933. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold2.png
  4934. share/doc/qt5/qtgraphicaleffects/images/ThresholdMask_threshold3.png
  4935. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_bug.png
  4936. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
  4937. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
  4938. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
  4939. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length1.png
  4940. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length2.png
  4941. share/doc/qt5/qtgraphicaleffects/images/ZoomBlur_length3.png
  4942. share/doc/qt5/qtgraphicaleffects/images/arrow_bc.png
  4943. share/doc/qt5/qtgraphicaleffects/images/bgrContent.png
  4944. share/doc/qt5/qtgraphicaleffects/images/btn_next.png
  4945. share/doc/qt5/qtgraphicaleffects/images/btn_prev.png
  4946. share/doc/qt5/qtgraphicaleffects/images/bullet_dn.png
  4947. share/doc/qt5/qtgraphicaleffects/images/bullet_sq.png
  4948. share/doc/qt5/qtgraphicaleffects/images/home.png
  4949. share/doc/qt5/qtgraphicaleffects/images/ico_note.png
  4950. share/doc/qt5/qtgraphicaleffects/images/ico_note_attention.png
  4951. share/doc/qt5/qtgraphicaleffects/images/ico_out.png
  4952. share/doc/qt5/qtgraphicaleffects/images/logo.png
  4953. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
  4954. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
  4955. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
  4956. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
  4957. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
  4958. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
  4959. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
  4960. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
  4961. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
  4962. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
  4963. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
  4964. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
  4965. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
  4966. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
  4967. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
  4968. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
  4969. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
  4970. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
  4971. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
  4972. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
  4973. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
  4974. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
  4975. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
  4976. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
  4977. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
  4978. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
  4979. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
  4980. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
  4981. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
  4982. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
  4983. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
  4984. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
  4985. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
  4986. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
  4987. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
  4988. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
  4989. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
  4990. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
  4991. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
  4992. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
  4993. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
  4994. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
  4995. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
  4996. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
  4997. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
  4998. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
  4999. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
  5000. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
  5001. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
  5002. share/doc/qt5/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
  5003. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-index.html
  5004. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
  5005. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.index
  5006. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp
  5007. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
  5008. share/doc/qt5/qtgraphicaleffects/qtgraphicaleffects.tags
  5009. share/doc/qt5/qtgraphicaleffects/style/offline-simple.css
  5010. share/doc/qt5/qtgraphicaleffects/style/offline.css
  5011. share/doc/qt5/qtgui.qch
  5012. share/doc/qt5/qtgui/coordsys.html
  5013. share/doc/qt5/qtgui/dnd.html
  5014. share/doc/qt5/qtgui/examples-manifest.xml
  5015. share/doc/qt5/qtgui/images/alphafill.png
  5016. share/doc/qt5/qtgui/images/analogclock-window-example.png
  5017. share/doc/qt5/qtgui/images/analogclockwindow-viewport.png
  5018. share/doc/qt5/qtgui/images/arrow_bc.png
  5019. share/doc/qt5/qtgui/images/bearings.png
  5020. share/doc/qt5/qtgui/images/bgrContent.png
  5021. share/doc/qt5/qtgui/images/brush-outline.png
  5022. share/doc/qt5/qtgui/images/brush-styles.png
  5023. share/doc/qt5/qtgui/images/btn_next.png
  5024. share/doc/qt5/qtgui/images/btn_prev.png
  5025. share/doc/qt5/qtgui/images/bullet_dn.png
  5026. share/doc/qt5/qtgui/images/bullet_sq.png
  5027. share/doc/qt5/qtgui/images/coordinatesystem-analogclock.png
  5028. share/doc/qt5/qtgui/images/coordinatesystem-line-antialias.png
  5029. share/doc/qt5/qtgui/images/coordinatesystem-line-raster.png
  5030. share/doc/qt5/qtgui/images/coordinatesystem-line.png
  5031. share/doc/qt5/qtgui/images/coordinatesystem-rect-antialias.png
  5032. share/doc/qt5/qtgui/images/coordinatesystem-rect-raster.png
  5033. share/doc/qt5/qtgui/images/coordinatesystem-rect.png
  5034. share/doc/qt5/qtgui/images/coordinatesystem-transformations.png
  5035. share/doc/qt5/qtgui/images/cursor-arrow.png
  5036. share/doc/qt5/qtgui/images/cursor-busy.png
  5037. share/doc/qt5/qtgui/images/cursor-closedhand.png
  5038. share/doc/qt5/qtgui/images/cursor-cross.png
  5039. share/doc/qt5/qtgui/images/cursor-forbidden.png
  5040. share/doc/qt5/qtgui/images/cursor-hand.png
  5041. share/doc/qt5/qtgui/images/cursor-hsplit.png
  5042. share/doc/qt5/qtgui/images/cursor-ibeam.png
  5043. share/doc/qt5/qtgui/images/cursor-openhand.png
  5044. share/doc/qt5/qtgui/images/cursor-sizeall.png
  5045. share/doc/qt5/qtgui/images/cursor-sizeb.png
  5046. share/doc/qt5/qtgui/images/cursor-sizef.png
  5047. share/doc/qt5/qtgui/images/cursor-sizeh.png
  5048. share/doc/qt5/qtgui/images/cursor-sizev.png
  5049. share/doc/qt5/qtgui/images/cursor-uparrow.png
  5050. share/doc/qt5/qtgui/images/cursor-vsplit.png
  5051. share/doc/qt5/qtgui/images/cursor-wait.png
  5052. share/doc/qt5/qtgui/images/cursor-whatsthis.png
  5053. share/doc/qt5/qtgui/images/hellovulkancubes.png
  5054. share/doc/qt5/qtgui/images/hellovulkantexture.png
  5055. share/doc/qt5/qtgui/images/hellovulkantriangle.png
  5056. share/doc/qt5/qtgui/images/hellovulkanwidget.png
  5057. share/doc/qt5/qtgui/images/hellovulkanwindow.png
  5058. share/doc/qt5/qtgui/images/home.png
  5059. share/doc/qt5/qtgui/images/hoverevents.png
  5060. share/doc/qt5/qtgui/images/ico_note.png
  5061. share/doc/qt5/qtgui/images/ico_note_attention.png
  5062. share/doc/qt5/qtgui/images/ico_out.png
  5063. share/doc/qt5/qtgui/images/icon.png
  5064. share/doc/qt5/qtgui/images/logo.png
  5065. share/doc/qt5/qtgui/images/openglwindow-example.png
  5066. share/doc/qt5/qtgui/images/paintsystem-antialiasing.png
  5067. share/doc/qt5/qtgui/images/paintsystem-core.png
  5068. share/doc/qt5/qtgui/images/paintsystem-fancygradient.png
  5069. share/doc/qt5/qtgui/images/paintsystem-gradients.png
  5070. share/doc/qt5/qtgui/images/paintsystem-movie.png
  5071. share/doc/qt5/qtgui/images/paintsystem-painterpath.png
  5072. share/doc/qt5/qtgui/images/palette.png
  5073. share/doc/qt5/qtgui/images/plaintext-layout.png
  5074. share/doc/qt5/qtgui/images/qcolor-cmyk.png
  5075. share/doc/qt5/qtgui/images/qcolor-hsv.png
  5076. share/doc/qt5/qtgui/images/qcolor-hue.png
  5077. share/doc/qt5/qtgui/images/qcolor-rgb.png
  5078. share/doc/qt5/qtgui/images/qcolor-saturation.png
  5079. share/doc/qt5/qtgui/images/qcolor-value.png
  5080. share/doc/qt5/qtgui/images/qconicalgradient.png
  5081. share/doc/qt5/qtgui/images/qgradient-conical.png
  5082. share/doc/qt5/qtgui/images/qgradient-linear.png
  5083. share/doc/qt5/qtgui/images/qgradient-radial.png
  5084. share/doc/qt5/qtgui/images/qimage-32bit_scaled.png
  5085. share/doc/qt5/qtgui/images/qimage-8bit_scaled.png
  5086. share/doc/qt5/qtgui/images/qimage-scaling.png
  5087. share/doc/qt5/qtgui/images/qlineargradient-pad.png
  5088. share/doc/qt5/qtgui/images/qlineargradient-reflect.png
  5089. share/doc/qt5/qtgui/images/qlineargradient-repeat.png
  5090. share/doc/qt5/qtgui/images/qmatrix-combinedtransformation.png
  5091. share/doc/qt5/qtgui/images/qmatrix-representation.png
  5092. share/doc/qt5/qtgui/images/qmatrix-simpletransformation.png
  5093. share/doc/qt5/qtgui/images/qpainter-affinetransformations.png
  5094. share/doc/qt5/qtgui/images/qpainter-arc.png
  5095. share/doc/qt5/qtgui/images/qpainter-basicdrawing.png
  5096. share/doc/qt5/qtgui/images/qpainter-chord.png
  5097. share/doc/qt5/qtgui/images/qpainter-clock.png
  5098. share/doc/qt5/qtgui/images/qpainter-compositiondemo.png
  5099. share/doc/qt5/qtgui/images/qpainter-compositionmode1.png
  5100. share/doc/qt5/qtgui/images/qpainter-compositionmode2.png
  5101. share/doc/qt5/qtgui/images/qpainter-concentriccircles.png
  5102. share/doc/qt5/qtgui/images/qpainter-ellipse.png
  5103. share/doc/qt5/qtgui/images/qpainter-gradients.png
  5104. share/doc/qt5/qtgui/images/qpainter-line.png
  5105. share/doc/qt5/qtgui/images/qpainter-painterpaths.png
  5106. share/doc/qt5/qtgui/images/qpainter-path.png
  5107. share/doc/qt5/qtgui/images/qpainter-pathstroking.png
  5108. share/doc/qt5/qtgui/images/qpainter-pie.png
  5109. share/doc/qt5/qtgui/images/qpainter-polygon.png
  5110. share/doc/qt5/qtgui/images/qpainter-rectangle.png
  5111. share/doc/qt5/qtgui/images/qpainter-rotation.png
  5112. share/doc/qt5/qtgui/images/qpainter-roundrect.png
  5113. share/doc/qt5/qtgui/images/qpainter-scale.png
  5114. share/doc/qt5/qtgui/images/qpainter-text-bounds.png
  5115. share/doc/qt5/qtgui/images/qpainter-text.png
  5116. share/doc/qt5/qtgui/images/qpainter-translation.png
  5117. share/doc/qt5/qtgui/images/qpainter-vectordeformation.png
  5118. share/doc/qt5/qtgui/images/qpainterpath-addellipse.png
  5119. share/doc/qt5/qtgui/images/qpainterpath-addpolygon.png
  5120. share/doc/qt5/qtgui/images/qpainterpath-addrectangle.png
  5121. share/doc/qt5/qtgui/images/qpainterpath-addtext.png
  5122. share/doc/qt5/qtgui/images/qpainterpath-arcto.png
  5123. share/doc/qt5/qtgui/images/qpainterpath-construction.png
  5124. share/doc/qt5/qtgui/images/qpainterpath-cubicto.png
  5125. share/doc/qt5/qtgui/images/qpainterpath-demo.png
  5126. share/doc/qt5/qtgui/images/qpainterpath-example.png
  5127. share/doc/qt5/qtgui/images/qpen-bevel.png
  5128. share/doc/qt5/qtgui/images/qpen-custom.png
  5129. share/doc/qt5/qtgui/images/qpen-dash.png
  5130. share/doc/qt5/qtgui/images/qpen-dashdot.png
  5131. share/doc/qt5/qtgui/images/qpen-dashdotdot.png
  5132. share/doc/qt5/qtgui/images/qpen-dashpattern.png
  5133. share/doc/qt5/qtgui/images/qpen-demo.png
  5134. share/doc/qt5/qtgui/images/qpen-dot.png
  5135. share/doc/qt5/qtgui/images/qpen-flat.png
  5136. share/doc/qt5/qtgui/images/qpen-miter.png
  5137. share/doc/qt5/qtgui/images/qpen-miterlimit.png
  5138. share/doc/qt5/qtgui/images/qpen-roundcap.png
  5139. share/doc/qt5/qtgui/images/qpen-roundjoin.png
  5140. share/doc/qt5/qtgui/images/qpen-solid.png
  5141. share/doc/qt5/qtgui/images/qpen-square.png
  5142. share/doc/qt5/qtgui/images/qpixelformat-argb32buffer.png
  5143. share/doc/qt5/qtgui/images/qradialgradient-pad.png
  5144. share/doc/qt5/qtgui/images/qradialgradient-reflect.png
  5145. share/doc/qt5/qtgui/images/qradialgradient-repeat.png
  5146. share/doc/qt5/qtgui/images/qrect-diagram-zero.png
  5147. share/doc/qt5/qtgui/images/qrectf-diagram-one.png
  5148. share/doc/qt5/qtgui/images/qrectf-diagram-three.png
  5149. share/doc/qt5/qtgui/images/qrectf-diagram-two.png
  5150. share/doc/qt5/qtgui/images/qstatustipevent-action.png
  5151. share/doc/qt5/qtgui/images/qstatustipevent-widget.png
  5152. share/doc/qt5/qtgui/images/qt-colors.png
  5153. share/doc/qt5/qtgui/images/qt-fillrule-oddeven.png
  5154. share/doc/qt5/qtgui/images/qt-fillrule-winding.png
  5155. share/doc/qt5/qtgui/images/qtabletevent-tilt.png
  5156. share/doc/qt5/qtgui/images/qtextblock-sequence.png
  5157. share/doc/qt5/qtgui/images/qtextfragment-split.png
  5158. share/doc/qt5/qtgui/images/qtextframe-style.png
  5159. share/doc/qt5/qtgui/images/qtexttableformat-cell.png
  5160. share/doc/qt5/qtgui/images/qtransform-combinedtransformation.png
  5161. share/doc/qt5/qtgui/images/qtransform-combinedtransformation2.png
  5162. share/doc/qt5/qtgui/images/qtransform-representation.png
  5163. share/doc/qt5/qtgui/images/qtransform-simpletransformation.png
  5164. share/doc/qt5/qtgui/images/richtext-document.png
  5165. share/doc/qt5/qtgui/images/rintersect.png
  5166. share/doc/qt5/qtgui/images/rsubtract.png
  5167. share/doc/qt5/qtgui/images/runion.png
  5168. share/doc/qt5/qtgui/images/rxor.png
  5169. share/doc/qt5/qtgui/images/texttable-merge.png
  5170. share/doc/qt5/qtgui/images/texttable-split.png
  5171. share/doc/qt5/qtgui/images/touchpoint-metrics.png
  5172. share/doc/qt5/qtgui/images/used-in-examples/hellovulkantexture/qt256.png
  5173. share/doc/qt5/qtgui/painting-3d.html
  5174. share/doc/qt5/qtgui/painting.html
  5175. share/doc/qt5/qtgui/paintsystem-devices.html
  5176. share/doc/qt5/qtgui/paintsystem-drawing.html
  5177. share/doc/qt5/qtgui/paintsystem-images.html
  5178. share/doc/qt5/qtgui/paintsystem.html
  5179. share/doc/qt5/qtgui/qabstractopenglfunctions-members.html
  5180. share/doc/qt5/qtgui/qabstractopenglfunctions.html
  5181. share/doc/qt5/qtgui/qabstracttextdocumentlayout-members.html
  5182. share/doc/qt5/qtgui/qabstracttextdocumentlayout-obsolete.html
  5183. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
  5184. share/doc/qt5/qtgui/qabstracttextdocumentlayout-paintcontext.html
  5185. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection-members.html
  5186. share/doc/qt5/qtgui/qabstracttextdocumentlayout-selection.html
  5187. share/doc/qt5/qtgui/qabstracttextdocumentlayout.html
  5188. share/doc/qt5/qtgui/qaccessible-members.html
  5189. share/doc/qt5/qtgui/qaccessible-obsolete.html
  5190. share/doc/qt5/qtgui/qaccessible-state-members.html
  5191. share/doc/qt5/qtgui/qaccessible-state.html
  5192. share/doc/qt5/qtgui/qaccessible.html
  5193. share/doc/qt5/qtgui/qaccessibleactioninterface-members.html
  5194. share/doc/qt5/qtgui/qaccessibleactioninterface.html
  5195. share/doc/qt5/qtgui/qaccessibleeditabletextinterface-members.html
  5196. share/doc/qt5/qtgui/qaccessibleeditabletextinterface.html
  5197. share/doc/qt5/qtgui/qaccessibleevent-members.html
  5198. share/doc/qt5/qtgui/qaccessibleevent.html
  5199. share/doc/qt5/qtgui/qaccessibleinterface-members.html
  5200. share/doc/qt5/qtgui/qaccessibleinterface.html
  5201. share/doc/qt5/qtgui/qaccessibleobject-members.html
  5202. share/doc/qt5/qtgui/qaccessibleobject.html
  5203. share/doc/qt5/qtgui/qaccessibleplugin-members.html
  5204. share/doc/qt5/qtgui/qaccessibleplugin-obsolete.html
  5205. share/doc/qt5/qtgui/qaccessibleplugin.html
  5206. share/doc/qt5/qtgui/qaccessiblestatechangeevent-members.html
  5207. share/doc/qt5/qtgui/qaccessiblestatechangeevent.html
  5208. share/doc/qt5/qtgui/qaccessibletablecellinterface-members.html
  5209. share/doc/qt5/qtgui/qaccessibletablecellinterface.html
  5210. share/doc/qt5/qtgui/qaccessibletableinterface-members.html
  5211. share/doc/qt5/qtgui/qaccessibletableinterface.html
  5212. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent-members.html
  5213. share/doc/qt5/qtgui/qaccessibletablemodelchangeevent.html
  5214. share/doc/qt5/qtgui/qaccessibletextcursorevent-members.html
  5215. share/doc/qt5/qtgui/qaccessibletextcursorevent.html
  5216. share/doc/qt5/qtgui/qaccessibletextinsertevent-members.html
  5217. share/doc/qt5/qtgui/qaccessibletextinsertevent.html
  5218. share/doc/qt5/qtgui/qaccessibletextinterface-members.html
  5219. share/doc/qt5/qtgui/qaccessibletextinterface.html
  5220. share/doc/qt5/qtgui/qaccessibletextremoveevent-members.html
  5221. share/doc/qt5/qtgui/qaccessibletextremoveevent.html
  5222. share/doc/qt5/qtgui/qaccessibletextselectionevent-members.html
  5223. share/doc/qt5/qtgui/qaccessibletextselectionevent.html
  5224. share/doc/qt5/qtgui/qaccessibletextupdateevent-members.html
  5225. share/doc/qt5/qtgui/qaccessibletextupdateevent.html
  5226. share/doc/qt5/qtgui/qaccessiblevaluechangeevent-members.html
  5227. share/doc/qt5/qtgui/qaccessiblevaluechangeevent.html
  5228. share/doc/qt5/qtgui/qaccessiblevalueinterface-members.html
  5229. share/doc/qt5/qtgui/qaccessiblevalueinterface.html
  5230. share/doc/qt5/qtgui/qactionevent-members.html
  5231. share/doc/qt5/qtgui/qactionevent.html
  5232. share/doc/qt5/qtgui/qbackingstore-members.html
  5233. share/doc/qt5/qtgui/qbackingstore.html
  5234. share/doc/qt5/qtgui/qbitmap-members.html
  5235. share/doc/qt5/qtgui/qbitmap-obsolete.html
  5236. share/doc/qt5/qtgui/qbitmap.html
  5237. share/doc/qt5/qtgui/qbrush-members.html
  5238. share/doc/qt5/qtgui/qbrush.html
  5239. share/doc/qt5/qtgui/qclipboard-members.html
  5240. share/doc/qt5/qtgui/qclipboard-obsolete.html
  5241. share/doc/qt5/qtgui/qclipboard.html
  5242. share/doc/qt5/qtgui/qcloseevent-members.html
  5243. share/doc/qt5/qtgui/qcloseevent.html
  5244. share/doc/qt5/qtgui/qcolor-members.html
  5245. share/doc/qt5/qtgui/qcolor-obsolete.html
  5246. share/doc/qt5/qtgui/qcolor.html
  5247. share/doc/qt5/qtgui/qconicalgradient-members.html
  5248. share/doc/qt5/qtgui/qconicalgradient.html
  5249. share/doc/qt5/qtgui/qcontextmenuevent-members.html
  5250. share/doc/qt5/qtgui/qcontextmenuevent.html
  5251. share/doc/qt5/qtgui/qcursor-members.html
  5252. share/doc/qt5/qtgui/qcursor.html
  5253. share/doc/qt5/qtgui/qdesktopservices-members.html
  5254. share/doc/qt5/qtgui/qdesktopservices-obsolete.html
  5255. share/doc/qt5/qtgui/qdesktopservices.html
  5256. share/doc/qt5/qtgui/qdoublevalidator-members.html
  5257. share/doc/qt5/qtgui/qdoublevalidator-obsolete.html
  5258. share/doc/qt5/qtgui/qdoublevalidator.html
  5259. share/doc/qt5/qtgui/qdrag-members.html
  5260. share/doc/qt5/qtgui/qdrag-obsolete.html
  5261. share/doc/qt5/qtgui/qdrag.html
  5262. share/doc/qt5/qtgui/qdragenterevent-members.html
  5263. share/doc/qt5/qtgui/qdragenterevent.html
  5264. share/doc/qt5/qtgui/qdragleaveevent-members.html
  5265. share/doc/qt5/qtgui/qdragleaveevent.html
  5266. share/doc/qt5/qtgui/qdragmoveevent-members.html
  5267. share/doc/qt5/qtgui/qdragmoveevent.html
  5268. share/doc/qt5/qtgui/qdropevent-members.html
  5269. share/doc/qt5/qtgui/qdropevent.html
  5270. share/doc/qt5/qtgui/qenterevent-members.html
  5271. share/doc/qt5/qtgui/qenterevent.html
  5272. share/doc/qt5/qtgui/qexposeevent-members.html
  5273. share/doc/qt5/qtgui/qexposeevent.html
  5274. share/doc/qt5/qtgui/qfileopenevent-members.html
  5275. share/doc/qt5/qtgui/qfileopenevent.html
  5276. share/doc/qt5/qtgui/qfocusevent-members.html
  5277. share/doc/qt5/qtgui/qfocusevent.html
  5278. share/doc/qt5/qtgui/qfont-members.html
  5279. share/doc/qt5/qtgui/qfont-obsolete.html
  5280. share/doc/qt5/qtgui/qfont.html
  5281. share/doc/qt5/qtgui/qfontdatabase-members.html
  5282. share/doc/qt5/qtgui/qfontdatabase-obsolete.html
  5283. share/doc/qt5/qtgui/qfontdatabase.html
  5284. share/doc/qt5/qtgui/qfontinfo-members.html
  5285. share/doc/qt5/qtgui/qfontinfo-obsolete.html
  5286. share/doc/qt5/qtgui/qfontinfo.html
  5287. share/doc/qt5/qtgui/qfontmetrics-members.html
  5288. share/doc/qt5/qtgui/qfontmetrics-obsolete.html
  5289. share/doc/qt5/qtgui/qfontmetrics.html
  5290. share/doc/qt5/qtgui/qfontmetricsf-members.html
  5291. share/doc/qt5/qtgui/qfontmetricsf-obsolete.html
  5292. share/doc/qt5/qtgui/qfontmetricsf.html
  5293. share/doc/qt5/qtgui/qgenericmatrix-members.html
  5294. share/doc/qt5/qtgui/qgenericmatrix.html
  5295. share/doc/qt5/qtgui/qgenericplugin-members.html
  5296. share/doc/qt5/qtgui/qgenericplugin-obsolete.html
  5297. share/doc/qt5/qtgui/qgenericplugin.html
  5298. share/doc/qt5/qtgui/qgenericpluginfactory-members.html
  5299. share/doc/qt5/qtgui/qgenericpluginfactory.html
  5300. share/doc/qt5/qtgui/qglyphrun-members.html
  5301. share/doc/qt5/qtgui/qglyphrun.html
  5302. share/doc/qt5/qtgui/qgradient-members.html
  5303. share/doc/qt5/qtgui/qgradient.html
  5304. share/doc/qt5/qtgui/qguiapplication-members.html
  5305. share/doc/qt5/qtgui/qguiapplication-obsolete.html
  5306. share/doc/qt5/qtgui/qguiapplication.html
  5307. share/doc/qt5/qtgui/qhelpevent-members.html
  5308. share/doc/qt5/qtgui/qhelpevent.html
  5309. share/doc/qt5/qtgui/qhideevent-members.html
  5310. share/doc/qt5/qtgui/qhideevent.html
  5311. share/doc/qt5/qtgui/qhoverevent-members.html
  5312. share/doc/qt5/qtgui/qhoverevent.html
  5313. share/doc/qt5/qtgui/qicon-members.html
  5314. share/doc/qt5/qtgui/qicon-obsolete.html
  5315. share/doc/qt5/qtgui/qicon.html
  5316. share/doc/qt5/qtgui/qicondragevent-members.html
  5317. share/doc/qt5/qtgui/qicondragevent.html
  5318. share/doc/qt5/qtgui/qiconengine-availablesizesargument-members.html
  5319. share/doc/qt5/qtgui/qiconengine-availablesizesargument.html
  5320. share/doc/qt5/qtgui/qiconengine-members.html
  5321. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument-members.html
  5322. share/doc/qt5/qtgui/qiconengine-scaledpixmapargument.html
  5323. share/doc/qt5/qtgui/qiconengine.html
  5324. share/doc/qt5/qtgui/qiconengineplugin-members.html
  5325. share/doc/qt5/qtgui/qiconengineplugin-obsolete.html
  5326. share/doc/qt5/qtgui/qiconengineplugin.html
  5327. share/doc/qt5/qtgui/qimage-members.html
  5328. share/doc/qt5/qtgui/qimage-obsolete.html
  5329. share/doc/qt5/qtgui/qimage.html
  5330. share/doc/qt5/qtgui/qimageiohandler-members.html
  5331. share/doc/qt5/qtgui/qimageiohandler-obsolete.html
  5332. share/doc/qt5/qtgui/qimageiohandler.html
  5333. share/doc/qt5/qtgui/qimageioplugin-members.html
  5334. share/doc/qt5/qtgui/qimageioplugin-obsolete.html
  5335. share/doc/qt5/qtgui/qimageioplugin.html
  5336. share/doc/qt5/qtgui/qimagereader-members.html
  5337. share/doc/qt5/qtgui/qimagereader.html
  5338. share/doc/qt5/qtgui/qimagewriter-members.html
  5339. share/doc/qt5/qtgui/qimagewriter-obsolete.html
  5340. share/doc/qt5/qtgui/qimagewriter.html
  5341. share/doc/qt5/qtgui/qinputevent-members.html
  5342. share/doc/qt5/qtgui/qinputevent.html
  5343. share/doc/qt5/qtgui/qinputmethod-members.html
  5344. share/doc/qt5/qtgui/qinputmethod-obsolete.html
  5345. share/doc/qt5/qtgui/qinputmethod.html
  5346. share/doc/qt5/qtgui/qinputmethodevent-attribute-members.html
  5347. share/doc/qt5/qtgui/qinputmethodevent-attribute.html
  5348. share/doc/qt5/qtgui/qinputmethodevent-members.html
  5349. share/doc/qt5/qtgui/qinputmethodevent.html
  5350. share/doc/qt5/qtgui/qinputmethodqueryevent-members.html
  5351. share/doc/qt5/qtgui/qinputmethodqueryevent.html
  5352. share/doc/qt5/qtgui/qintvalidator-members.html
  5353. share/doc/qt5/qtgui/qintvalidator-obsolete.html
  5354. share/doc/qt5/qtgui/qintvalidator.html
  5355. share/doc/qt5/qtgui/qkeyevent-members.html
  5356. share/doc/qt5/qtgui/qkeyevent.html
  5357. share/doc/qt5/qtgui/qkeysequence-members.html
  5358. share/doc/qt5/qtgui/qkeysequence-obsolete.html
  5359. share/doc/qt5/qtgui/qkeysequence.html
  5360. share/doc/qt5/qtgui/qlineargradient-members.html
  5361. share/doc/qt5/qtgui/qlineargradient.html
  5362. share/doc/qt5/qtgui/qmatrix-members.html
  5363. share/doc/qt5/qtgui/qmatrix.html
  5364. share/doc/qt5/qtgui/qmatrix4x4-members.html
  5365. share/doc/qt5/qtgui/qmatrix4x4-obsolete.html
  5366. share/doc/qt5/qtgui/qmatrix4x4.html
  5367. share/doc/qt5/qtgui/qmouseevent-members.html
  5368. share/doc/qt5/qtgui/qmouseevent-obsolete.html
  5369. share/doc/qt5/qtgui/qmouseevent.html
  5370. share/doc/qt5/qtgui/qmoveevent-members.html
  5371. share/doc/qt5/qtgui/qmoveevent.html
  5372. share/doc/qt5/qtgui/qmovie-members.html
  5373. share/doc/qt5/qtgui/qmovie-obsolete.html
  5374. share/doc/qt5/qtgui/qmovie.html
  5375. share/doc/qt5/qtgui/qnativegestureevent-members.html
  5376. share/doc/qt5/qtgui/qnativegestureevent-obsolete.html
  5377. share/doc/qt5/qtgui/qnativegestureevent.html
  5378. share/doc/qt5/qtgui/qoffscreensurface-members.html
  5379. share/doc/qt5/qtgui/qoffscreensurface-obsolete.html
  5380. share/doc/qt5/qtgui/qoffscreensurface.html
  5381. share/doc/qt5/qtgui/qopenglbuffer-members.html
  5382. share/doc/qt5/qtgui/qopenglbuffer.html
  5383. share/doc/qt5/qtgui/qopenglcontext-members.html
  5384. share/doc/qt5/qtgui/qopenglcontext-obsolete.html
  5385. share/doc/qt5/qtgui/qopenglcontext.html
  5386. share/doc/qt5/qtgui/qopenglcontextgroup-members.html
  5387. share/doc/qt5/qtgui/qopenglcontextgroup-obsolete.html
  5388. share/doc/qt5/qtgui/qopenglcontextgroup.html
  5389. share/doc/qt5/qtgui/qopengldebuglogger-members.html
  5390. share/doc/qt5/qtgui/qopengldebuglogger-obsolete.html
  5391. share/doc/qt5/qtgui/qopengldebuglogger.html
  5392. share/doc/qt5/qtgui/qopengldebugmessage-members.html
  5393. share/doc/qt5/qtgui/qopengldebugmessage.html
  5394. share/doc/qt5/qtgui/qopenglextrafunctions-members.html
  5395. share/doc/qt5/qtgui/qopenglextrafunctions-obsolete.html
  5396. share/doc/qt5/qtgui/qopenglextrafunctions.html
  5397. share/doc/qt5/qtgui/qopenglframebufferobject-members.html
  5398. share/doc/qt5/qtgui/qopenglframebufferobject.html
  5399. share/doc/qt5/qtgui/qopenglframebufferobjectformat-members.html
  5400. share/doc/qt5/qtgui/qopenglframebufferobjectformat.html
  5401. share/doc/qt5/qtgui/qopenglfunctions-1-0-members.html
  5402. share/doc/qt5/qtgui/qopenglfunctions-1-0.html
  5403. share/doc/qt5/qtgui/qopenglfunctions-1-1-members.html
  5404. share/doc/qt5/qtgui/qopenglfunctions-1-1.html
  5405. share/doc/qt5/qtgui/qopenglfunctions-1-2-members.html
  5406. share/doc/qt5/qtgui/qopenglfunctions-1-2.html
  5407. share/doc/qt5/qtgui/qopenglfunctions-1-3-members.html
  5408. share/doc/qt5/qtgui/qopenglfunctions-1-3.html
  5409. share/doc/qt5/qtgui/qopenglfunctions-1-4-members.html
  5410. share/doc/qt5/qtgui/qopenglfunctions-1-4.html
  5411. share/doc/qt5/qtgui/qopenglfunctions-1-5-members.html
  5412. share/doc/qt5/qtgui/qopenglfunctions-1-5.html
  5413. share/doc/qt5/qtgui/qopenglfunctions-2-0-members.html
  5414. share/doc/qt5/qtgui/qopenglfunctions-2-0.html
  5415. share/doc/qt5/qtgui/qopenglfunctions-2-1-members.html
  5416. share/doc/qt5/qtgui/qopenglfunctions-2-1.html
  5417. share/doc/qt5/qtgui/qopenglfunctions-3-0-members.html
  5418. share/doc/qt5/qtgui/qopenglfunctions-3-0.html
  5419. share/doc/qt5/qtgui/qopenglfunctions-3-1-members.html
  5420. share/doc/qt5/qtgui/qopenglfunctions-3-1.html
  5421. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility-members.html
  5422. share/doc/qt5/qtgui/qopenglfunctions-3-2-compatibility.html
  5423. share/doc/qt5/qtgui/qopenglfunctions-3-2-core-members.html
  5424. share/doc/qt5/qtgui/qopenglfunctions-3-2-core.html
  5425. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility-members.html
  5426. share/doc/qt5/qtgui/qopenglfunctions-3-3-compatibility.html
  5427. share/doc/qt5/qtgui/qopenglfunctions-3-3-core-members.html
  5428. share/doc/qt5/qtgui/qopenglfunctions-3-3-core.html
  5429. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility-members.html
  5430. share/doc/qt5/qtgui/qopenglfunctions-4-0-compatibility.html
  5431. share/doc/qt5/qtgui/qopenglfunctions-4-0-core-members.html
  5432. share/doc/qt5/qtgui/qopenglfunctions-4-0-core.html
  5433. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility-members.html
  5434. share/doc/qt5/qtgui/qopenglfunctions-4-1-compatibility.html
  5435. share/doc/qt5/qtgui/qopenglfunctions-4-1-core-members.html
  5436. share/doc/qt5/qtgui/qopenglfunctions-4-1-core.html
  5437. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility-members.html
  5438. share/doc/qt5/qtgui/qopenglfunctions-4-2-compatibility.html
  5439. share/doc/qt5/qtgui/qopenglfunctions-4-2-core-members.html
  5440. share/doc/qt5/qtgui/qopenglfunctions-4-2-core.html
  5441. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility-members.html
  5442. share/doc/qt5/qtgui/qopenglfunctions-4-3-compatibility.html
  5443. share/doc/qt5/qtgui/qopenglfunctions-4-3-core-members.html
  5444. share/doc/qt5/qtgui/qopenglfunctions-4-3-core.html
  5445. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility-members.html
  5446. share/doc/qt5/qtgui/qopenglfunctions-4-4-compatibility.html
  5447. share/doc/qt5/qtgui/qopenglfunctions-4-4-core-members.html
  5448. share/doc/qt5/qtgui/qopenglfunctions-4-4-core.html
  5449. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility-members.html
  5450. share/doc/qt5/qtgui/qopenglfunctions-4-5-compatibility.html
  5451. share/doc/qt5/qtgui/qopenglfunctions-4-5-core-members.html
  5452. share/doc/qt5/qtgui/qopenglfunctions-4-5-core.html
  5453. share/doc/qt5/qtgui/qopenglfunctions-es2-members.html
  5454. share/doc/qt5/qtgui/qopenglfunctions-es2.html
  5455. share/doc/qt5/qtgui/qopenglfunctions-members.html
  5456. share/doc/qt5/qtgui/qopenglfunctions-obsolete.html
  5457. share/doc/qt5/qtgui/qopenglfunctions.html
  5458. share/doc/qt5/qtgui/qopenglpaintdevice-members.html
  5459. share/doc/qt5/qtgui/qopenglpaintdevice.html
  5460. share/doc/qt5/qtgui/qopenglpixeltransferoptions-members.html
  5461. share/doc/qt5/qtgui/qopenglpixeltransferoptions.html
  5462. share/doc/qt5/qtgui/qopenglshader-members.html
  5463. share/doc/qt5/qtgui/qopenglshader-obsolete.html
  5464. share/doc/qt5/qtgui/qopenglshader.html
  5465. share/doc/qt5/qtgui/qopenglshaderprogram-members.html
  5466. share/doc/qt5/qtgui/qopenglshaderprogram-obsolete.html
  5467. share/doc/qt5/qtgui/qopenglshaderprogram.html
  5468. share/doc/qt5/qtgui/qopengltexture-members.html
  5469. share/doc/qt5/qtgui/qopengltexture-obsolete.html
  5470. share/doc/qt5/qtgui/qopengltexture.html
  5471. share/doc/qt5/qtgui/qopengltextureblitter-members.html
  5472. share/doc/qt5/qtgui/qopengltextureblitter.html
  5473. share/doc/qt5/qtgui/qopengltimemonitor-members.html
  5474. share/doc/qt5/qtgui/qopengltimemonitor-obsolete.html
  5475. share/doc/qt5/qtgui/qopengltimemonitor.html
  5476. share/doc/qt5/qtgui/qopengltimerquery-members.html
  5477. share/doc/qt5/qtgui/qopengltimerquery-obsolete.html
  5478. share/doc/qt5/qtgui/qopengltimerquery.html
  5479. share/doc/qt5/qtgui/qopenglversionprofile-members.html
  5480. share/doc/qt5/qtgui/qopenglversionprofile.html
  5481. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder-members.html
  5482. share/doc/qt5/qtgui/qopenglvertexarrayobject-binder.html
  5483. share/doc/qt5/qtgui/qopenglvertexarrayobject-members.html
  5484. share/doc/qt5/qtgui/qopenglvertexarrayobject-obsolete.html
  5485. share/doc/qt5/qtgui/qopenglvertexarrayobject.html
  5486. share/doc/qt5/qtgui/qopenglwindow-members.html
  5487. share/doc/qt5/qtgui/qopenglwindow-obsolete.html
  5488. share/doc/qt5/qtgui/qopenglwindow.html
  5489. share/doc/qt5/qtgui/qpagedpaintdevice-margins-members.html
  5490. share/doc/qt5/qtgui/qpagedpaintdevice-margins.html
  5491. share/doc/qt5/qtgui/qpagedpaintdevice-members.html
  5492. share/doc/qt5/qtgui/qpagedpaintdevice-obsolete.html
  5493. share/doc/qt5/qtgui/qpagedpaintdevice.html
  5494. share/doc/qt5/qtgui/qpagelayout-members.html
  5495. share/doc/qt5/qtgui/qpagelayout.html
  5496. share/doc/qt5/qtgui/qpagesize-members.html
  5497. share/doc/qt5/qtgui/qpagesize.html
  5498. share/doc/qt5/qtgui/qpaintdevice-members.html
  5499. share/doc/qt5/qtgui/qpaintdevice.html
  5500. share/doc/qt5/qtgui/qpaintdevicewindow-members.html
  5501. share/doc/qt5/qtgui/qpaintdevicewindow-obsolete.html
  5502. share/doc/qt5/qtgui/qpaintdevicewindow.html
  5503. share/doc/qt5/qtgui/qpaintengine-members.html
  5504. share/doc/qt5/qtgui/qpaintengine.html
  5505. share/doc/qt5/qtgui/qpaintenginestate-members.html
  5506. share/doc/qt5/qtgui/qpaintenginestate-obsolete.html
  5507. share/doc/qt5/qtgui/qpaintenginestate.html
  5508. share/doc/qt5/qtgui/qpainter-members.html
  5509. share/doc/qt5/qtgui/qpainter-obsolete.html
  5510. share/doc/qt5/qtgui/qpainter-pixmapfragment-members.html
  5511. share/doc/qt5/qtgui/qpainter-pixmapfragment.html
  5512. share/doc/qt5/qtgui/qpainter.html
  5513. share/doc/qt5/qtgui/qpainterpath-element-members.html
  5514. share/doc/qt5/qtgui/qpainterpath-element.html
  5515. share/doc/qt5/qtgui/qpainterpath-members.html
  5516. share/doc/qt5/qtgui/qpainterpath-obsolete.html
  5517. share/doc/qt5/qtgui/qpainterpath.html
  5518. share/doc/qt5/qtgui/qpainterpathstroker-members.html
  5519. share/doc/qt5/qtgui/qpainterpathstroker.html
  5520. share/doc/qt5/qtgui/qpaintevent-members.html
  5521. share/doc/qt5/qtgui/qpaintevent.html
  5522. share/doc/qt5/qtgui/qpalette-members.html
  5523. share/doc/qt5/qtgui/qpalette-obsolete.html
  5524. share/doc/qt5/qtgui/qpalette.html
  5525. share/doc/qt5/qtgui/qpdfwriter-members.html
  5526. share/doc/qt5/qtgui/qpdfwriter-obsolete.html
  5527. share/doc/qt5/qtgui/qpdfwriter.html
  5528. share/doc/qt5/qtgui/qpen-members.html
  5529. share/doc/qt5/qtgui/qpen.html
  5530. share/doc/qt5/qtgui/qpicture-members.html
  5531. share/doc/qt5/qtgui/qpicture.html
  5532. share/doc/qt5/qtgui/qpictureformatplugin-members.html
  5533. share/doc/qt5/qtgui/qpictureformatplugin-obsolete.html
  5534. share/doc/qt5/qtgui/qpictureformatplugin.html
  5535. share/doc/qt5/qtgui/qpictureio-members.html
  5536. share/doc/qt5/qtgui/qpictureio.html
  5537. share/doc/qt5/qtgui/qpixelformat-members.html
  5538. share/doc/qt5/qtgui/qpixelformat.html
  5539. share/doc/qt5/qtgui/qpixmap-members.html
  5540. share/doc/qt5/qtgui/qpixmap-obsolete.html
  5541. share/doc/qt5/qtgui/qpixmap.html
  5542. share/doc/qt5/qtgui/qpixmapcache-key-members.html
  5543. share/doc/qt5/qtgui/qpixmapcache-key.html
  5544. share/doc/qt5/qtgui/qpixmapcache-keydata-members.html
  5545. share/doc/qt5/qtgui/qpixmapcache-keydata.html
  5546. share/doc/qt5/qtgui/qpixmapcache-members.html
  5547. share/doc/qt5/qtgui/qpixmapcache-obsolete.html
  5548. share/doc/qt5/qtgui/qpixmapcache.html
  5549. share/doc/qt5/qtgui/qplatformsurfaceevent-members.html
  5550. share/doc/qt5/qtgui/qplatformsurfaceevent.html
  5551. share/doc/qt5/qtgui/qpointingdeviceuniqueid-members.html
  5552. share/doc/qt5/qtgui/qpointingdeviceuniqueid.html
  5553. share/doc/qt5/qtgui/qpolygon-members.html
  5554. share/doc/qt5/qtgui/qpolygon.html
  5555. share/doc/qt5/qtgui/qpolygonf-members.html
  5556. share/doc/qt5/qtgui/qpolygonf.html
  5557. share/doc/qt5/qtgui/qquaternion-members.html
  5558. share/doc/qt5/qtgui/qquaternion-obsolete.html
  5559. share/doc/qt5/qtgui/qquaternion.html
  5560. share/doc/qt5/qtgui/qradialgradient-members.html
  5561. share/doc/qt5/qtgui/qradialgradient.html
  5562. share/doc/qt5/qtgui/qrasterpaintengine-members.html
  5563. share/doc/qt5/qtgui/qrasterpaintengine.html
  5564. share/doc/qt5/qtgui/qrasterwindow-members.html
  5565. share/doc/qt5/qtgui/qrasterwindow-obsolete.html
  5566. share/doc/qt5/qtgui/qrasterwindow.html
  5567. share/doc/qt5/qtgui/qrawfont-members.html
  5568. share/doc/qt5/qtgui/qrawfont.html
  5569. share/doc/qt5/qtgui/qregexpvalidator-members.html
  5570. share/doc/qt5/qtgui/qregexpvalidator-obsolete.html
  5571. share/doc/qt5/qtgui/qregexpvalidator.html
  5572. share/doc/qt5/qtgui/qregion-members.html
  5573. share/doc/qt5/qtgui/qregion-obsolete.html
  5574. share/doc/qt5/qtgui/qregion.html
  5575. share/doc/qt5/qtgui/qregularexpressionvalidator-members.html
  5576. share/doc/qt5/qtgui/qregularexpressionvalidator-obsolete.html
  5577. share/doc/qt5/qtgui/qregularexpressionvalidator.html
  5578. share/doc/qt5/qtgui/qresizeevent-members.html
  5579. share/doc/qt5/qtgui/qresizeevent.html
  5580. share/doc/qt5/qtgui/qrgba64-members.html
  5581. share/doc/qt5/qtgui/qrgba64.html
  5582. share/doc/qt5/qtgui/qscreen-members.html
  5583. share/doc/qt5/qtgui/qscreen-obsolete.html
  5584. share/doc/qt5/qtgui/qscreen.html
  5585. share/doc/qt5/qtgui/qscrollevent-members.html
  5586. share/doc/qt5/qtgui/qscrollevent.html
  5587. share/doc/qt5/qtgui/qscrollprepareevent-members.html
  5588. share/doc/qt5/qtgui/qscrollprepareevent.html
  5589. share/doc/qt5/qtgui/qsessionmanager-members.html
  5590. share/doc/qt5/qtgui/qsessionmanager-obsolete.html
  5591. share/doc/qt5/qtgui/qsessionmanager.html
  5592. share/doc/qt5/qtgui/qshortcutevent-members.html
  5593. share/doc/qt5/qtgui/qshortcutevent.html
  5594. share/doc/qt5/qtgui/qshowevent-members.html
  5595. share/doc/qt5/qtgui/qshowevent.html
  5596. share/doc/qt5/qtgui/qstandarditem-members.html
  5597. share/doc/qt5/qtgui/qstandarditem-obsolete.html
  5598. share/doc/qt5/qtgui/qstandarditem.html
  5599. share/doc/qt5/qtgui/qstandarditemmodel-members.html
  5600. share/doc/qt5/qtgui/qstandarditemmodel-obsolete.html
  5601. share/doc/qt5/qtgui/qstandarditemmodel.html
  5602. share/doc/qt5/qtgui/qstatictext-members.html
  5603. share/doc/qt5/qtgui/qstatictext.html
  5604. share/doc/qt5/qtgui/qstatustipevent-members.html
  5605. share/doc/qt5/qtgui/qstatustipevent.html
  5606. share/doc/qt5/qtgui/qstylehints-members.html
  5607. share/doc/qt5/qtgui/qstylehints-obsolete.html
  5608. share/doc/qt5/qtgui/qstylehints.html
  5609. share/doc/qt5/qtgui/qsupportedwritingsystems-members.html
  5610. share/doc/qt5/qtgui/qsupportedwritingsystems.html
  5611. share/doc/qt5/qtgui/qsurface-members.html
  5612. share/doc/qt5/qtgui/qsurface.html
  5613. share/doc/qt5/qtgui/qsurfaceformat-members.html
  5614. share/doc/qt5/qtgui/qsurfaceformat-obsolete.html
  5615. share/doc/qt5/qtgui/qsurfaceformat.html
  5616. share/doc/qt5/qtgui/qsyntaxhighlighter-members.html
  5617. share/doc/qt5/qtgui/qsyntaxhighlighter-obsolete.html
  5618. share/doc/qt5/qtgui/qsyntaxhighlighter.html
  5619. share/doc/qt5/qtgui/qt-sub-qtgui.html
  5620. share/doc/qt5/qtgui/qtabletevent-members.html
  5621. share/doc/qt5/qtgui/qtabletevent-obsolete.html
  5622. share/doc/qt5/qtgui/qtabletevent.html
  5623. share/doc/qt5/qtgui/qtextblock-iterator-members.html
  5624. share/doc/qt5/qtgui/qtextblock-iterator.html
  5625. share/doc/qt5/qtgui/qtextblock-members.html
  5626. share/doc/qt5/qtgui/qtextblock.html
  5627. share/doc/qt5/qtgui/qtextblockformat-members.html
  5628. share/doc/qt5/qtgui/qtextblockformat.html
  5629. share/doc/qt5/qtgui/qtextblockgroup-members.html
  5630. share/doc/qt5/qtgui/qtextblockgroup-obsolete.html
  5631. share/doc/qt5/qtgui/qtextblockgroup.html
  5632. share/doc/qt5/qtgui/qtextblockuserdata-members.html
  5633. share/doc/qt5/qtgui/qtextblockuserdata.html
  5634. share/doc/qt5/qtgui/qtextcharformat-members.html
  5635. share/doc/qt5/qtgui/qtextcharformat-obsolete.html
  5636. share/doc/qt5/qtgui/qtextcharformat.html
  5637. share/doc/qt5/qtgui/qtextcursor-members.html
  5638. share/doc/qt5/qtgui/qtextcursor.html
  5639. share/doc/qt5/qtgui/qtextdocument-members.html
  5640. share/doc/qt5/qtgui/qtextdocument-obsolete.html
  5641. share/doc/qt5/qtgui/qtextdocument.html
  5642. share/doc/qt5/qtgui/qtextdocumentfragment-members.html
  5643. share/doc/qt5/qtgui/qtextdocumentfragment.html
  5644. share/doc/qt5/qtgui/qtextdocumentwriter-members.html
  5645. share/doc/qt5/qtgui/qtextdocumentwriter.html
  5646. share/doc/qt5/qtgui/qtextformat-members.html
  5647. share/doc/qt5/qtgui/qtextformat.html
  5648. share/doc/qt5/qtgui/qtextfragment-members.html
  5649. share/doc/qt5/qtgui/qtextfragment.html
  5650. share/doc/qt5/qtgui/qtextframe-iterator-members.html
  5651. share/doc/qt5/qtgui/qtextframe-iterator.html
  5652. share/doc/qt5/qtgui/qtextframe-members.html
  5653. share/doc/qt5/qtgui/qtextframe-obsolete.html
  5654. share/doc/qt5/qtgui/qtextframe.html
  5655. share/doc/qt5/qtgui/qtextframeformat-members.html
  5656. share/doc/qt5/qtgui/qtextframeformat.html
  5657. share/doc/qt5/qtgui/qtextimageformat-members.html
  5658. share/doc/qt5/qtgui/qtextimageformat-obsolete.html
  5659. share/doc/qt5/qtgui/qtextimageformat.html
  5660. share/doc/qt5/qtgui/qtextinlineobject-members.html
  5661. share/doc/qt5/qtgui/qtextinlineobject.html
  5662. share/doc/qt5/qtgui/qtextitem-members.html
  5663. share/doc/qt5/qtgui/qtextitem.html
  5664. share/doc/qt5/qtgui/qtextlayout-formatrange-members.html
  5665. share/doc/qt5/qtgui/qtextlayout-formatrange.html
  5666. share/doc/qt5/qtgui/qtextlayout-members.html
  5667. share/doc/qt5/qtgui/qtextlayout-obsolete.html
  5668. share/doc/qt5/qtgui/qtextlayout.html
  5669. share/doc/qt5/qtgui/qtextlength-members.html
  5670. share/doc/qt5/qtgui/qtextlength.html
  5671. share/doc/qt5/qtgui/qtextline-members.html
  5672. share/doc/qt5/qtgui/qtextline.html
  5673. share/doc/qt5/qtgui/qtextlist-members.html
  5674. share/doc/qt5/qtgui/qtextlist-obsolete.html
  5675. share/doc/qt5/qtgui/qtextlist.html
  5676. share/doc/qt5/qtgui/qtextlistformat-members.html
  5677. share/doc/qt5/qtgui/qtextlistformat.html
  5678. share/doc/qt5/qtgui/qtextobject-members.html
  5679. share/doc/qt5/qtgui/qtextobject-obsolete.html
  5680. share/doc/qt5/qtgui/qtextobject.html
  5681. share/doc/qt5/qtgui/qtextobjectinterface-members.html
  5682. share/doc/qt5/qtgui/qtextobjectinterface.html
  5683. share/doc/qt5/qtgui/qtextoption-members.html
  5684. share/doc/qt5/qtgui/qtextoption-obsolete.html
  5685. share/doc/qt5/qtgui/qtextoption-tab-members.html
  5686. share/doc/qt5/qtgui/qtextoption-tab.html
  5687. share/doc/qt5/qtgui/qtextoption.html
  5688. share/doc/qt5/qtgui/qtexttable-members.html
  5689. share/doc/qt5/qtgui/qtexttable-obsolete.html
  5690. share/doc/qt5/qtgui/qtexttable.html
  5691. share/doc/qt5/qtgui/qtexttablecell-members.html
  5692. share/doc/qt5/qtgui/qtexttablecell.html
  5693. share/doc/qt5/qtgui/qtexttablecellformat-members.html
  5694. share/doc/qt5/qtgui/qtexttablecellformat-obsolete.html
  5695. share/doc/qt5/qtgui/qtexttablecellformat.html
  5696. share/doc/qt5/qtgui/qtexttableformat-members.html
  5697. share/doc/qt5/qtgui/qtexttableformat.html
  5698. share/doc/qt5/qtgui/qtgui-analogclock-analogclock-pro.html
  5699. share/doc/qt5/qtgui/qtgui-analogclock-example.html
  5700. share/doc/qt5/qtgui/qtgui-analogclock-main-cpp.html
  5701. share/doc/qt5/qtgui/qtgui-attribution-android-native-style.html
  5702. share/doc/qt5/qtgui/qtgui-attribution-angle-arrayboundsclamper.html
  5703. share/doc/qt5/qtgui/qtgui-attribution-angle-murmurhash.html
  5704. share/doc/qt5/qtgui/qtgui-attribution-angle-systeminfo.html
  5705. share/doc/qt5/qtgui/qtgui-attribution-angle-trace-event.html
  5706. share/doc/qt5/qtgui/qtgui-attribution-angle.html
  5707. share/doc/qt5/qtgui/qtgui-attribution-cocoa-platform-plugin.html
  5708. share/doc/qt5/qtgui/qtgui-attribution-dejayvu.html
  5709. share/doc/qt5/qtgui/qtgui-attribution-freetype-bdf.html
  5710. share/doc/qt5/qtgui/qtgui-attribution-freetype-pcf.html
  5711. share/doc/qt5/qtgui/qtgui-attribution-freetype-zlib.html
  5712. share/doc/qt5/qtgui/qtgui-attribution-freetype.html
  5713. share/doc/qt5/qtgui/qtgui-attribution-grayraster.html
  5714. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz-ng.html
  5715. share/doc/qt5/qtgui/qtgui-attribution-harfbuzz.html
  5716. share/doc/qt5/qtgui/qtgui-attribution-iaccessible2.html
  5717. share/doc/qt5/qtgui/qtgui-attribution-icc-srgb-color-profile.html
  5718. share/doc/qt5/qtgui/qtgui-attribution-libjpeg.html
  5719. share/doc/qt5/qtgui/qtgui-attribution-libpng.html
  5720. share/doc/qt5/qtgui/qtgui-attribution-opengl-es2-headers.html
  5721. share/doc/qt5/qtgui/qtgui-attribution-opengl-headers.html
  5722. share/doc/qt5/qtgui/qtgui-attribution-pixman.html
  5723. share/doc/qt5/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
  5724. share/doc/qt5/qtgui/qtgui-attribution-vera-font.html
  5725. share/doc/qt5/qtgui/qtgui-attribution-vulkan-xml-spec.html
  5726. share/doc/qt5/qtgui/qtgui-attribution-webgradients.html
  5727. share/doc/qt5/qtgui/qtgui-attribution-wintab.html
  5728. share/doc/qt5/qtgui/qtgui-attribution-xcb.html
  5729. share/doc/qt5/qtgui/qtgui-hellovulkancubes-camera-cpp.html
  5730. share/doc/qt5/qtgui/qtgui-hellovulkancubes-camera-h.html
  5731. share/doc/qt5/qtgui/qtgui-hellovulkancubes-example.html
  5732. share/doc/qt5/qtgui/qtgui-hellovulkancubes-hellovulkancubes-pro.html
  5733. share/doc/qt5/qtgui/qtgui-hellovulkancubes-hellovulkancubes-qrc.html
  5734. share/doc/qt5/qtgui/qtgui-hellovulkancubes-main-cpp.html
  5735. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mainwindow-cpp.html
  5736. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mainwindow-h.html
  5737. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mesh-cpp.html
  5738. share/doc/qt5/qtgui/qtgui-hellovulkancubes-mesh-h.html
  5739. share/doc/qt5/qtgui/qtgui-hellovulkancubes-renderer-cpp.html
  5740. share/doc/qt5/qtgui/qtgui-hellovulkancubes-renderer-h.html
  5741. share/doc/qt5/qtgui/qtgui-hellovulkancubes-shader-cpp.html
  5742. share/doc/qt5/qtgui/qtgui-hellovulkancubes-shader-h.html
  5743. share/doc/qt5/qtgui/qtgui-hellovulkancubes-vulkanwindow-cpp.html
  5744. share/doc/qt5/qtgui/qtgui-hellovulkancubes-vulkanwindow-h.html
  5745. share/doc/qt5/qtgui/qtgui-hellovulkantexture-example.html
  5746. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-cpp.html
  5747. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-h.html
  5748. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-pro.html
  5749. share/doc/qt5/qtgui/qtgui-hellovulkantexture-hellovulkantexture-qrc.html
  5750. share/doc/qt5/qtgui/qtgui-hellovulkantexture-main-cpp.html
  5751. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-example.html
  5752. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-pro.html
  5753. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-hellovulkantriangle-qrc.html
  5754. share/doc/qt5/qtgui/qtgui-hellovulkantriangle-main-cpp.html
  5755. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-example.html
  5756. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-cpp.html
  5757. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-h.html
  5758. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-pro.html
  5759. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-hellovulkanwidget-qrc.html
  5760. share/doc/qt5/qtgui/qtgui-hellovulkanwidget-main-cpp.html
  5761. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-example.html
  5762. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-cpp.html
  5763. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-h.html
  5764. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-hellovulkanwindow-pro.html
  5765. share/doc/qt5/qtgui/qtgui-hellovulkanwindow-main-cpp.html
  5766. share/doc/qt5/qtgui/qtgui-index.html
  5767. share/doc/qt5/qtgui/qtgui-module.html
  5768. share/doc/qt5/qtgui/qtgui-openglwindow-example.html
  5769. share/doc/qt5/qtgui/qtgui-openglwindow-main-cpp.html
  5770. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-cpp.html
  5771. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-h.html
  5772. share/doc/qt5/qtgui/qtgui-openglwindow-openglwindow-pro.html
  5773. share/doc/qt5/qtgui/qtgui-rasterwindow-example.html
  5774. share/doc/qt5/qtgui/qtgui-rasterwindow-main-cpp.html
  5775. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-cpp.html
  5776. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-h.html
  5777. share/doc/qt5/qtgui/qtgui-rasterwindow-rasterwindow-pro.html
  5778. share/doc/qt5/qtgui/qtgui.index
  5779. share/doc/qt5/qtgui/qtgui.qhp
  5780. share/doc/qt5/qtgui/qtgui.qhp.sha1
  5781. share/doc/qt5/qtgui/qtgui.tags
  5782. share/doc/qt5/qtgui/qtouchdevice-members.html
  5783. share/doc/qt5/qtgui/qtouchdevice.html
  5784. share/doc/qt5/qtgui/qtouchevent-members.html
  5785. share/doc/qt5/qtgui/qtouchevent-obsolete.html
  5786. share/doc/qt5/qtgui/qtouchevent-touchpoint-members.html
  5787. share/doc/qt5/qtgui/qtouchevent-touchpoint-obsolete.html
  5788. share/doc/qt5/qtgui/qtouchevent-touchpoint.html
  5789. share/doc/qt5/qtgui/qtouchevent.html
  5790. share/doc/qt5/qtgui/qtransform-members.html
  5791. share/doc/qt5/qtgui/qtransform-obsolete.html
  5792. share/doc/qt5/qtgui/qtransform.html
  5793. share/doc/qt5/qtgui/qvalidator-members.html
  5794. share/doc/qt5/qtgui/qvalidator-obsolete.html
  5795. share/doc/qt5/qtgui/qvalidator.html
  5796. share/doc/qt5/qtgui/qvector2d-members.html
  5797. share/doc/qt5/qtgui/qvector2d.html
  5798. share/doc/qt5/qtgui/qvector3d-members.html
  5799. share/doc/qt5/qtgui/qvector3d.html
  5800. share/doc/qt5/qtgui/qvector4d-members.html
  5801. share/doc/qt5/qtgui/qvector4d.html
  5802. share/doc/qt5/qtgui/qvulkanextension-members.html
  5803. share/doc/qt5/qtgui/qvulkanextension.html
  5804. share/doc/qt5/qtgui/qvulkaninfovector-members.html
  5805. share/doc/qt5/qtgui/qvulkaninfovector.html
  5806. share/doc/qt5/qtgui/qvulkaninstance-members.html
  5807. share/doc/qt5/qtgui/qvulkaninstance.html
  5808. share/doc/qt5/qtgui/qvulkanlayer-members.html
  5809. share/doc/qt5/qtgui/qvulkanlayer.html
  5810. share/doc/qt5/qtgui/qvulkanwindow-members.html
  5811. share/doc/qt5/qtgui/qvulkanwindow-obsolete.html
  5812. share/doc/qt5/qtgui/qvulkanwindow.html
  5813. share/doc/qt5/qtgui/qvulkanwindowrenderer-members.html
  5814. share/doc/qt5/qtgui/qvulkanwindowrenderer.html
  5815. share/doc/qt5/qtgui/qwhatsthisclickedevent-members.html
  5816. share/doc/qt5/qtgui/qwhatsthisclickedevent.html
  5817. share/doc/qt5/qtgui/qwheelevent-members.html
  5818. share/doc/qt5/qtgui/qwheelevent-obsolete.html
  5819. share/doc/qt5/qtgui/qwheelevent.html
  5820. share/doc/qt5/qtgui/qwindow-members.html
  5821. share/doc/qt5/qtgui/qwindow-obsolete.html
  5822. share/doc/qt5/qtgui/qwindow.html
  5823. share/doc/qt5/qtgui/qwindowstatechangeevent-members.html
  5824. share/doc/qt5/qtgui/qwindowstatechangeevent.html
  5825. share/doc/qt5/qtgui/richtext-advanced-processing.html
  5826. share/doc/qt5/qtgui/richtext-common-tasks.html
  5827. share/doc/qt5/qtgui/richtext-cursor.html
  5828. share/doc/qt5/qtgui/richtext-html-subset.html
  5829. share/doc/qt5/qtgui/richtext-layouts.html
  5830. share/doc/qt5/qtgui/richtext-processing.html
  5831. share/doc/qt5/qtgui/richtext-structure.html
  5832. share/doc/qt5/qtgui/richtext.html
  5833. share/doc/qt5/qtgui/style/offline-simple.css
  5834. share/doc/qt5/qtgui/style/offline.css
  5835. share/doc/qt5/qthelp.qch
  5836. share/doc/qt5/qthelp/examples-manifest.xml
  5837. share/doc/qt5/qthelp/examples-qthelp.html
  5838. share/doc/qt5/qthelp/helpsystem.html
  5839. share/doc/qt5/qthelp/images/arrow_bc.png
  5840. share/doc/qt5/qthelp/images/bgrContent.png
  5841. share/doc/qt5/qthelp/images/btn_next.png
  5842. share/doc/qt5/qthelp/images/btn_prev.png
  5843. share/doc/qt5/qthelp/images/bullet_dn.png
  5844. share/doc/qt5/qthelp/images/bullet_sq.png
  5845. share/doc/qt5/qthelp/images/home.png
  5846. share/doc/qt5/qthelp/images/ico_note.png
  5847. share/doc/qt5/qthelp/images/ico_note_attention.png
  5848. share/doc/qt5/qthelp/images/ico_out.png
  5849. share/doc/qt5/qthelp/images/logo.png
  5850. share/doc/qt5/qthelp/qhelpcontentitem-members.html
  5851. share/doc/qt5/qthelp/qhelpcontentitem.html
  5852. share/doc/qt5/qthelp/qhelpcontentmodel-members.html
  5853. share/doc/qt5/qthelp/qhelpcontentmodel-obsolete.html
  5854. share/doc/qt5/qthelp/qhelpcontentmodel.html
  5855. share/doc/qt5/qthelp/qhelpcontentwidget-members.html
  5856. share/doc/qt5/qthelp/qhelpcontentwidget-obsolete.html
  5857. share/doc/qt5/qthelp/qhelpcontentwidget.html
  5858. share/doc/qt5/qthelp/qhelpengine-members.html
  5859. share/doc/qt5/qthelp/qhelpengine-obsolete.html
  5860. share/doc/qt5/qthelp/qhelpengine.html
  5861. share/doc/qt5/qthelp/qhelpenginecore-members.html
  5862. share/doc/qt5/qthelp/qhelpenginecore-obsolete.html
  5863. share/doc/qt5/qthelp/qhelpenginecore.html
  5864. share/doc/qt5/qthelp/qhelpindexmodel-members.html
  5865. share/doc/qt5/qthelp/qhelpindexmodel-obsolete.html
  5866. share/doc/qt5/qthelp/qhelpindexmodel.html
  5867. share/doc/qt5/qthelp/qhelpindexwidget-members.html
  5868. share/doc/qt5/qthelp/qhelpindexwidget-obsolete.html
  5869. share/doc/qt5/qthelp/qhelpindexwidget.html
  5870. share/doc/qt5/qthelp/qhelpsearchengine-members.html
  5871. share/doc/qt5/qthelp/qhelpsearchengine-obsolete.html
  5872. share/doc/qt5/qthelp/qhelpsearchengine.html
  5873. share/doc/qt5/qthelp/qhelpsearchquery-members.html
  5874. share/doc/qt5/qthelp/qhelpsearchquery.html
  5875. share/doc/qt5/qthelp/qhelpsearchquerywidget-members.html
  5876. share/doc/qt5/qthelp/qhelpsearchquerywidget-obsolete.html
  5877. share/doc/qt5/qthelp/qhelpsearchquerywidget.html
  5878. share/doc/qt5/qthelp/qhelpsearchresult-members.html
  5879. share/doc/qt5/qthelp/qhelpsearchresult.html
  5880. share/doc/qt5/qthelp/qhelpsearchresultwidget-members.html
  5881. share/doc/qt5/qthelp/qhelpsearchresultwidget-obsolete.html
  5882. share/doc/qt5/qthelp/qhelpsearchresultwidget.html
  5883. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-contextsensitivehelp-pro.html
  5884. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhcp.html
  5885. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-docs-wateringmachine-qhp.html
  5886. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-example.html
  5887. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-cpp.html
  5888. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-helpbrowser-h.html
  5889. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-main-cpp.html
  5890. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-cpp.html
  5891. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-h.html
  5892. share/doc/qt5/qthelp/qthelp-contextsensitivehelp-wateringconfigdialog-ui.html
  5893. share/doc/qt5/qthelp/qthelp-framework.html
  5894. share/doc/qt5/qthelp/qthelp-index.html
  5895. share/doc/qt5/qthelp/qthelp-module.html
  5896. share/doc/qt5/qthelp/qthelp.index
  5897. share/doc/qt5/qthelp/qthelp.qhp
  5898. share/doc/qt5/qthelp/qthelp.qhp.sha1
  5899. share/doc/qt5/qthelp/qthelpproject.html
  5900. share/doc/qt5/qthelp/style/offline-simple.css
  5901. share/doc/qt5/qthelp/style/offline.css
  5902. share/doc/qt5/qtimageformats.qch
  5903. share/doc/qt5/qtimageformats/images/arrow_bc.png
  5904. share/doc/qt5/qtimageformats/images/bgrContent.png
  5905. share/doc/qt5/qtimageformats/images/btn_next.png
  5906. share/doc/qt5/qtimageformats/images/btn_prev.png
  5907. share/doc/qt5/qtimageformats/images/bullet_dn.png
  5908. share/doc/qt5/qtimageformats/images/bullet_sq.png
  5909. share/doc/qt5/qtimageformats/images/home.png
  5910. share/doc/qt5/qtimageformats/images/ico_note.png
  5911. share/doc/qt5/qtimageformats/images/ico_note_attention.png
  5912. share/doc/qt5/qtimageformats/images/ico_out.png
  5913. share/doc/qt5/qtimageformats/images/logo.png
  5914. share/doc/qt5/qtimageformats/qtimageformats-attribution-libtiff.html
  5915. share/doc/qt5/qtimageformats/qtimageformats-attribution-libwebp.html
  5916. share/doc/qt5/qtimageformats/qtimageformats-index.html
  5917. share/doc/qt5/qtimageformats/qtimageformats.index
  5918. share/doc/qt5/qtimageformats/qtimageformats.qhp
  5919. share/doc/qt5/qtimageformats/qtimageformats.qhp.sha1
  5920. share/doc/qt5/qtimageformats/style/offline-simple.css
  5921. share/doc/qt5/qtimageformats/style/offline.css
  5922. share/doc/qt5/qtlabscalendar.qch
  5923. share/doc/qt5/qtlabscalendar/images/arrow_bc.png
  5924. share/doc/qt5/qtlabscalendar/images/bgrContent.png
  5925. share/doc/qt5/qtlabscalendar/images/btn_next.png
  5926. share/doc/qt5/qtlabscalendar/images/btn_prev.png
  5927. share/doc/qt5/qtlabscalendar/images/bullet_dn.png
  5928. share/doc/qt5/qtlabscalendar/images/bullet_sq.png
  5929. share/doc/qt5/qtlabscalendar/images/home.png
  5930. share/doc/qt5/qtlabscalendar/images/ico_note.png
  5931. share/doc/qt5/qtlabscalendar/images/ico_note_attention.png
  5932. share/doc/qt5/qtlabscalendar/images/ico_out.png
  5933. share/doc/qt5/qtlabscalendar/images/logo.png
  5934. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow-layout.png
  5935. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-dayofweekrow.png
  5936. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid-layout.png
  5937. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-monthgrid.png
  5938. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn-layout.png
  5939. share/doc/qt5/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn.png
  5940. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar-members.html
  5941. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendar.html
  5942. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel-members.html
  5943. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-calendarmodel.html
  5944. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow-members.html
  5945. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow.html
  5946. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid-members.html
  5947. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-monthgrid.html
  5948. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn-members.html
  5949. share/doc/qt5/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn.html
  5950. share/doc/qt5/qtlabscalendar/qt-labs-calendar-qmlmodule.html
  5951. share/doc/qt5/qtlabscalendar/qtlabscalendar-index.html
  5952. share/doc/qt5/qtlabscalendar/qtlabscalendar.index
  5953. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp
  5954. share/doc/qt5/qtlabscalendar/qtlabscalendar.qhp.sha1
  5955. share/doc/qt5/qtlabscalendar/qtlabscalendar.tags
  5956. share/doc/qt5/qtlabscalendar/style/offline-simple.css
  5957. share/doc/qt5/qtlabscalendar/style/offline.css
  5958. share/doc/qt5/qtlabsplatform.qch
  5959. share/doc/qt5/qtlabsplatform/images/arrow_bc.png
  5960. share/doc/qt5/qtlabsplatform/images/bgrContent.png
  5961. share/doc/qt5/qtlabsplatform/images/btn_next.png
  5962. share/doc/qt5/qtlabsplatform/images/btn_prev.png
  5963. share/doc/qt5/qtlabsplatform/images/bullet_dn.png
  5964. share/doc/qt5/qtlabsplatform/images/bullet_sq.png
  5965. share/doc/qt5/qtlabsplatform/images/home.png
  5966. share/doc/qt5/qtlabsplatform/images/ico_note.png
  5967. share/doc/qt5/qtlabsplatform/images/ico_note_attention.png
  5968. share/doc/qt5/qtlabsplatform/images/ico_out.png
  5969. share/doc/qt5/qtlabsplatform/images/logo.png
  5970. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
  5971. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
  5972. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
  5973. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
  5974. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menu.png
  5975. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-menubar.png
  5976. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
  5977. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
  5978. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
  5979. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
  5980. share/doc/qt5/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
  5981. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
  5982. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-colordialog.html
  5983. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
  5984. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-dialog.html
  5985. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
  5986. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-filedialog.html
  5987. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
  5988. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
  5989. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
  5990. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
  5991. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu-members.html
  5992. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu-obsolete.html
  5993. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menu.html
  5994. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
  5995. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menubar.html
  5996. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
  5997. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem-obsolete.html
  5998. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitem.html
  5999. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
  6000. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
  6001. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
  6002. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
  6003. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
  6004. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
  6005. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
  6006. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
  6007. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
  6008. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-obsolete.html
  6009. share/doc/qt5/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
  6010. share/doc/qt5/qtlabsplatform/qt-labs-platform-qmlmodule.html
  6011. share/doc/qt5/qtlabsplatform/qtlabsplatform-index.html
  6012. share/doc/qt5/qtlabsplatform/qtlabsplatform.index
  6013. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp
  6014. share/doc/qt5/qtlabsplatform/qtlabsplatform.qhp.sha1
  6015. share/doc/qt5/qtlabsplatform/qtlabsplatform.tags
  6016. share/doc/qt5/qtlabsplatform/style/offline-simple.css
  6017. share/doc/qt5/qtlabsplatform/style/offline.css
  6018. share/doc/qt5/qtlinguist.qch
  6019. share/doc/qt5/qtlinguist/examples-linguist.html
  6020. share/doc/qt5/qtlinguist/examples-manifest.xml
  6021. share/doc/qt5/qtlinguist/images/arrow_bc.png
  6022. share/doc/qt5/qtlinguist/images/bgrContent.png
  6023. share/doc/qt5/qtlinguist/images/btn_next.png
  6024. share/doc/qt5/qtlinguist/images/btn_prev.png
  6025. share/doc/qt5/qtlinguist/images/bullet_dn.png
  6026. share/doc/qt5/qtlinguist/images/bullet_sq.png
  6027. share/doc/qt5/qtlinguist/images/home.png
  6028. share/doc/qt5/qtlinguist/images/ico_note.png
  6029. share/doc/qt5/qtlinguist/images/ico_note_attention.png
  6030. share/doc/qt5/qtlinguist/images/ico_out.png
  6031. share/doc/qt5/qtlinguist/images/linguist-arrowpad_en.png
  6032. share/doc/qt5/qtlinguist/images/linguist-arrowpad_fr.png
  6033. share/doc/qt5/qtlinguist/images/linguist-arrowpad_nl.png
  6034. share/doc/qt5/qtlinguist/images/linguist-batchtranslation.png
  6035. share/doc/qt5/qtlinguist/images/linguist-check-empty.png
  6036. share/doc/qt5/qtlinguist/images/linguist-check-obsolete.png
  6037. share/doc/qt5/qtlinguist/images/linguist-check-off.png
  6038. share/doc/qt5/qtlinguist/images/linguist-check-on.png
  6039. share/doc/qt5/qtlinguist/images/linguist-check-warning.png
  6040. share/doc/qt5/qtlinguist/images/linguist-danger.png
  6041. share/doc/qt5/qtlinguist/images/linguist-doneandnext.png
  6042. share/doc/qt5/qtlinguist/images/linguist-hellotr_en.png
  6043. share/doc/qt5/qtlinguist/images/linguist-hellotr_la.png
  6044. share/doc/qt5/qtlinguist/images/linguist-linguist.png
  6045. share/doc/qt5/qtlinguist/images/linguist-linguist_2.png
  6046. share/doc/qt5/qtlinguist/images/linguist-phrasebookdialog.png
  6047. share/doc/qt5/qtlinguist/images/linguist-translationfilesettings.png
  6048. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_en.png
  6049. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_bad.png
  6050. share/doc/qt5/qtlinguist/images/linguist-trollprint_10_pt_good.png
  6051. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_en.png
  6052. share/doc/qt5/qtlinguist/images/linguist-trollprint_11_pt.png
  6053. share/doc/qt5/qtlinguist/images/logo.png
  6054. share/doc/qt5/qtlinguist/linguist-id-based-i18n.html
  6055. share/doc/qt5/qtlinguist/linguist-manager.html
  6056. share/doc/qt5/qtlinguist/linguist-overview.html
  6057. share/doc/qt5/qtlinguist/linguist-programmers.html
  6058. share/doc/qt5/qtlinguist/linguist-translators.html
  6059. share/doc/qt5/qtlinguist/linguist-ts-file-format.html
  6060. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-cpp.html
  6061. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-h.html
  6062. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-arrowpad-pro.html
  6063. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-example.html
  6064. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-main-cpp.html
  6065. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-cpp.html
  6066. share/doc/qt5/qtlinguist/qtlinguist-arrowpad-mainwindow-h.html
  6067. share/doc/qt5/qtlinguist/qtlinguist-hellotr-example.html
  6068. share/doc/qt5/qtlinguist/qtlinguist-hellotr-hellotr-pro.html
  6069. share/doc/qt5/qtlinguist/qtlinguist-hellotr-main-cpp.html
  6070. share/doc/qt5/qtlinguist/qtlinguist-index.html
  6071. share/doc/qt5/qtlinguist/qtlinguist-trollprint-example.html
  6072. share/doc/qt5/qtlinguist/qtlinguist-trollprint-main-cpp.html
  6073. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-cpp.html
  6074. share/doc/qt5/qtlinguist/qtlinguist-trollprint-mainwindow-h.html
  6075. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-cpp.html
  6076. share/doc/qt5/qtlinguist/qtlinguist-trollprint-printpanel-h.html
  6077. share/doc/qt5/qtlinguist/qtlinguist-trollprint-trollprint-pro.html
  6078. share/doc/qt5/qtlinguist/qtlinguist.index
  6079. share/doc/qt5/qtlinguist/qtlinguist.qhp
  6080. share/doc/qt5/qtlinguist/qtlinguist.qhp.sha1
  6081. share/doc/qt5/qtlinguist/style/offline-simple.css
  6082. share/doc/qt5/qtlinguist/style/offline.css
  6083. share/doc/qt5/qtlocation.qch
  6084. share/doc/qt5/qtlocation/examples-manifest.xml
  6085. share/doc/qt5/qtlocation/images/api-mapcircle.png
  6086. share/doc/qt5/qtlocation/images/api-mapitemgroup.png
  6087. share/doc/qt5/qtlocation/images/api-mappolygon.png
  6088. share/doc/qt5/qtlocation/images/api-mappolyline.png
  6089. share/doc/qt5/qtlocation/images/api-mapquickitem-anchor.png
  6090. share/doc/qt5/qtlocation/images/api-mapquickitem.png
  6091. share/doc/qt5/qtlocation/images/api-maprectangle.png
  6092. share/doc/qt5/qtlocation/images/arrow_bc.png
  6093. share/doc/qt5/qtlocation/images/bgrContent.png
  6094. share/doc/qt5/qtlocation/images/btn_next.png
  6095. share/doc/qt5/qtlocation/images/btn_prev.png
  6096. share/doc/qt5/qtlocation/images/bullet_dn.png
  6097. share/doc/qt5/qtlocation/images/bullet_sq.png
  6098. share/doc/qt5/qtlocation/images/home.png
  6099. share/doc/qt5/qtlocation/images/ico_note.png
  6100. share/doc/qt5/qtlocation/images/ico_note_attention.png
  6101. share/doc/qt5/qtlocation/images/ico_out.png
  6102. share/doc/qt5/qtlocation/images/logo.png
  6103. share/doc/qt5/qtlocation/images/mapviewer.png
  6104. share/doc/qt5/qtlocation/images/minimal_map.png
  6105. share/doc/qt5/qtlocation/images/places.png
  6106. share/doc/qt5/qtlocation/images/places_list.png
  6107. share/doc/qt5/qtlocation/images/places_map.png
  6108. share/doc/qt5/qtlocation/images/planespotter.png
  6109. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/icon.png
  6110. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/marker.png
  6111. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/scale.png
  6112. share/doc/qt5/qtlocation/images/used-in-examples/mapviewer/resources/scale_end.png
  6113. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/categories.png
  6114. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/left.png
  6115. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/marker.png
  6116. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/right.png
  6117. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/scale.png
  6118. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/scale_end.png
  6119. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/search.png
  6120. share/doc/qt5/qtlocation/images/used-in-examples/places/resources/star.png
  6121. share/doc/qt5/qtlocation/images/used-in-examples/places_list/marker.png
  6122. share/doc/qt5/qtlocation/images/used-in-examples/places_map/marker.png
  6123. share/doc/qt5/qtlocation/images/used-in-examples/planespotter/airplane.png
  6124. share/doc/qt5/qtlocation/location-cpp-qml.html
  6125. share/doc/qt5/qtlocation/location-maps-cpp.html
  6126. share/doc/qt5/qtlocation/location-maps-qml.html
  6127. share/doc/qt5/qtlocation/location-places-backend.html
  6128. share/doc/qt5/qtlocation/location-places-cpp.html
  6129. share/doc/qt5/qtlocation/location-places-qml.html
  6130. share/doc/qt5/qtlocation/location-plugin-esri.html
  6131. share/doc/qt5/qtlocation/location-plugin-here.html
  6132. share/doc/qt5/qtlocation/location-plugin-itemsoverlay.html
  6133. share/doc/qt5/qtlocation/location-plugin-mapbox.html
  6134. share/doc/qt5/qtlocation/location-plugin-mapboxgl.html
  6135. share/doc/qt5/qtlocation/location-plugin-osm.html
  6136. share/doc/qt5/qtlocation/qgeocodereply-members.html
  6137. share/doc/qt5/qtlocation/qgeocodereply-obsolete.html
  6138. share/doc/qt5/qtlocation/qgeocodereply.html
  6139. share/doc/qt5/qtlocation/qgeocodingmanager-members.html
  6140. share/doc/qt5/qtlocation/qgeocodingmanager-obsolete.html
  6141. share/doc/qt5/qtlocation/qgeocodingmanager.html
  6142. share/doc/qt5/qtlocation/qgeocodingmanagerengine-members.html
  6143. share/doc/qt5/qtlocation/qgeocodingmanagerengine-obsolete.html
  6144. share/doc/qt5/qtlocation/qgeocodingmanagerengine.html
  6145. share/doc/qt5/qtlocation/qgeomaneuver-members.html
  6146. share/doc/qt5/qtlocation/qgeomaneuver.html
  6147. share/doc/qt5/qtlocation/qgeoroute-members.html
  6148. share/doc/qt5/qtlocation/qgeoroute.html
  6149. share/doc/qt5/qtlocation/qgeorouteleg-members.html
  6150. share/doc/qt5/qtlocation/qgeorouteleg.html
  6151. share/doc/qt5/qtlocation/qgeoroutereply-members.html
  6152. share/doc/qt5/qtlocation/qgeoroutereply-obsolete.html
  6153. share/doc/qt5/qtlocation/qgeoroutereply.html
  6154. share/doc/qt5/qtlocation/qgeorouterequest-members.html
  6155. share/doc/qt5/qtlocation/qgeorouterequest.html
  6156. share/doc/qt5/qtlocation/qgeoroutesegment-members.html
  6157. share/doc/qt5/qtlocation/qgeoroutesegment.html
  6158. share/doc/qt5/qtlocation/qgeoroutingmanager-members.html
  6159. share/doc/qt5/qtlocation/qgeoroutingmanager-obsolete.html
  6160. share/doc/qt5/qtlocation/qgeoroutingmanager.html
  6161. share/doc/qt5/qtlocation/qgeoroutingmanagerengine-members.html
  6162. share/doc/qt5/qtlocation/qgeoroutingmanagerengine-obsolete.html
  6163. share/doc/qt5/qtlocation/qgeoroutingmanagerengine.html
  6164. share/doc/qt5/qtlocation/qgeoserviceprovider-members.html
  6165. share/doc/qt5/qtlocation/qgeoserviceprovider-obsolete.html
  6166. share/doc/qt5/qtlocation/qgeoserviceprovider.html
  6167. share/doc/qt5/qtlocation/qgeoserviceproviderfactory-members.html
  6168. share/doc/qt5/qtlocation/qgeoserviceproviderfactory.html
  6169. share/doc/qt5/qtlocation/qgeoserviceproviderfactoryv2-members.html
  6170. share/doc/qt5/qtlocation/qgeoserviceproviderfactoryv2.html
  6171. share/doc/qt5/qtlocation/qlocation.html
  6172. share/doc/qt5/qtlocation/qml-location5-maps.html
  6173. share/doc/qt5/qtlocation/qml-qt-labs-location-mapcircleobject-members.html
  6174. share/doc/qt5/qtlocation/qml-qt-labs-location-mapcircleobject.html
  6175. share/doc/qt5/qtlocation/qml-qt-labs-location-mapiconobject-members.html
  6176. share/doc/qt5/qtlocation/qml-qt-labs-location-mapiconobject.html
  6177. share/doc/qt5/qtlocation/qml-qt-labs-location-mapobjectview-members.html
  6178. share/doc/qt5/qtlocation/qml-qt-labs-location-mapobjectview.html
  6179. share/doc/qt5/qtlocation/qml-qt-labs-location-mappolygonobject-members.html
  6180. share/doc/qt5/qtlocation/qml-qt-labs-location-mappolygonobject.html
  6181. share/doc/qt5/qtlocation/qml-qt-labs-location-mappolylineobject-members.html
  6182. share/doc/qt5/qtlocation/qml-qt-labs-location-mappolylineobject.html
  6183. share/doc/qt5/qtlocation/qml-qt-labs-location-maprouteobject-members.html
  6184. share/doc/qt5/qtlocation/qml-qt-labs-location-maprouteobject.html
  6185. share/doc/qt5/qtlocation/qml-qt-labs-location-navigator-members.html
  6186. share/doc/qt5/qtlocation/qml-qt-labs-location-navigator.html
  6187. share/doc/qt5/qtlocation/qml-qtlocation-cameracapabilities-members.html
  6188. share/doc/qt5/qtlocation/qml-qtlocation-cameracapabilities.html
  6189. share/doc/qt5/qtlocation/qml-qtlocation-category-members.html
  6190. share/doc/qt5/qtlocation/qml-qtlocation-category.html
  6191. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel-members.html
  6192. share/doc/qt5/qtlocation/qml-qtlocation-categorymodel.html
  6193. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail-members.html
  6194. share/doc/qt5/qtlocation/qml-qtlocation-contactdetail.html
  6195. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails-members.html
  6196. share/doc/qt5/qtlocation/qml-qtlocation-contactdetails.html
  6197. share/doc/qt5/qtlocation/qml-qtlocation-dynamicparameter-members.html
  6198. share/doc/qt5/qtlocation/qml-qtlocation-dynamicparameter.html
  6199. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel-members.html
  6200. share/doc/qt5/qtlocation/qml-qtlocation-editorialmodel.html
  6201. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes-members.html
  6202. share/doc/qt5/qtlocation/qml-qtlocation-extendedattributes.html
  6203. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel-members.html
  6204. share/doc/qt5/qtlocation/qml-qtlocation-geocodemodel.html
  6205. share/doc/qt5/qtlocation/qml-qtlocation-icon-members.html
  6206. share/doc/qt5/qtlocation/qml-qtlocation-icon.html
  6207. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel-members.html
  6208. share/doc/qt5/qtlocation/qml-qtlocation-imagemodel.html
  6209. share/doc/qt5/qtlocation/qml-qtlocation-map-members.html
  6210. share/doc/qt5/qtlocation/qml-qtlocation-map.html
  6211. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle-members.html
  6212. share/doc/qt5/qtlocation/qml-qtlocation-mapcircle.html
  6213. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
  6214. share/doc/qt5/qtlocation/qml-qtlocation-mapcopyrightnotice.html
  6215. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea-members.html
  6216. share/doc/qt5/qtlocation/qml-qtlocation-mapgesturearea.html
  6217. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup-members.html
  6218. share/doc/qt5/qtlocation/qml-qtlocation-mapitemgroup.html
  6219. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview-members.html
  6220. share/doc/qt5/qtlocation/qml-qtlocation-mapitemview.html
  6221. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter-members.html
  6222. share/doc/qt5/qtlocation/qml-qtlocation-mapparameter.html
  6223. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent-members.html
  6224. share/doc/qt5/qtlocation/qml-qtlocation-mappinchevent.html
  6225. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon-members.html
  6226. share/doc/qt5/qtlocation/qml-qtlocation-mappolygon.html
  6227. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline-members.html
  6228. share/doc/qt5/qtlocation/qml-qtlocation-mappolyline.html
  6229. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem-members.html
  6230. share/doc/qt5/qtlocation/qml-qtlocation-mapquickitem.html
  6231. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle-members.html
  6232. share/doc/qt5/qtlocation/qml-qtlocation-maprectangle.html
  6233. share/doc/qt5/qtlocation/qml-qtlocation-maproute-members.html
  6234. share/doc/qt5/qtlocation/qml-qtlocation-maproute.html
  6235. share/doc/qt5/qtlocation/qml-qtlocation-maptype-members.html
  6236. share/doc/qt5/qtlocation/qml-qtlocation-maptype.html
  6237. share/doc/qt5/qtlocation/qml-qtlocation-place-members.html
  6238. share/doc/qt5/qtlocation/qml-qtlocation-place.html
  6239. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute-members.html
  6240. share/doc/qt5/qtlocation/qml-qtlocation-placeattribute.html
  6241. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel-members.html
  6242. share/doc/qt5/qtlocation/qml-qtlocation-placesearchmodel.html
  6243. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
  6244. share/doc/qt5/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
  6245. share/doc/qt5/qtlocation/qml-qtlocation-plugin-members.html
  6246. share/doc/qt5/qtlocation/qml-qtlocation-plugin.html
  6247. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter-members.html
  6248. share/doc/qt5/qtlocation/qml-qtlocation-pluginparameter.html
  6249. share/doc/qt5/qtlocation/qml-qtlocation-ratings-members.html
  6250. share/doc/qt5/qtlocation/qml-qtlocation-ratings.html
  6251. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel-members.html
  6252. share/doc/qt5/qtlocation/qml-qtlocation-reviewmodel.html
  6253. share/doc/qt5/qtlocation/qml-qtlocation-route-members.html
  6254. share/doc/qt5/qtlocation/qml-qtlocation-route.html
  6255. share/doc/qt5/qtlocation/qml-qtlocation-routeleg-members.html
  6256. share/doc/qt5/qtlocation/qml-qtlocation-routeleg.html
  6257. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver-members.html
  6258. share/doc/qt5/qtlocation/qml-qtlocation-routemaneuver.html
  6259. share/doc/qt5/qtlocation/qml-qtlocation-routemodel-members.html
  6260. share/doc/qt5/qtlocation/qml-qtlocation-routemodel.html
  6261. share/doc/qt5/qtlocation/qml-qtlocation-routequery-members.html
  6262. share/doc/qt5/qtlocation/qml-qtlocation-routequery.html
  6263. share/doc/qt5/qtlocation/qml-qtlocation-routesegment-members.html
  6264. share/doc/qt5/qtlocation/qml-qtlocation-routesegment.html
  6265. share/doc/qt5/qtlocation/qml-qtlocation-supplier-members.html
  6266. share/doc/qt5/qtlocation/qml-qtlocation-supplier.html
  6267. share/doc/qt5/qtlocation/qml-qtlocation-user-members.html
  6268. share/doc/qt5/qtlocation/qml-qtlocation-user.html
  6269. share/doc/qt5/qtlocation/qml-qtlocation-waypoint-members.html
  6270. share/doc/qt5/qtlocation/qml-qtlocation-waypoint.html
  6271. share/doc/qt5/qtlocation/qml-qtlocation5-maps.html
  6272. share/doc/qt5/qtlocation/qplace-members.html
  6273. share/doc/qt5/qtlocation/qplace.html
  6274. share/doc/qt5/qtlocation/qplaceattribute-members.html
  6275. share/doc/qt5/qtlocation/qplaceattribute.html
  6276. share/doc/qt5/qtlocation/qplacecategory-members.html
  6277. share/doc/qt5/qtlocation/qplacecategory.html
  6278. share/doc/qt5/qtlocation/qplacecontactdetail-members.html
  6279. share/doc/qt5/qtlocation/qplacecontactdetail.html
  6280. share/doc/qt5/qtlocation/qplacecontent-members.html
  6281. share/doc/qt5/qtlocation/qplacecontent.html
  6282. share/doc/qt5/qtlocation/qplacecontentreply-members.html
  6283. share/doc/qt5/qtlocation/qplacecontentreply-obsolete.html
  6284. share/doc/qt5/qtlocation/qplacecontentreply.html
  6285. share/doc/qt5/qtlocation/qplacecontentrequest-members.html
  6286. share/doc/qt5/qtlocation/qplacecontentrequest.html
  6287. share/doc/qt5/qtlocation/qplacedetailsreply-members.html
  6288. share/doc/qt5/qtlocation/qplacedetailsreply-obsolete.html
  6289. share/doc/qt5/qtlocation/qplacedetailsreply.html
  6290. share/doc/qt5/qtlocation/qplaceeditorial-members.html
  6291. share/doc/qt5/qtlocation/qplaceeditorial.html
  6292. share/doc/qt5/qtlocation/qplaceicon-members.html
  6293. share/doc/qt5/qtlocation/qplaceicon.html
  6294. share/doc/qt5/qtlocation/qplaceidreply-members.html
  6295. share/doc/qt5/qtlocation/qplaceidreply-obsolete.html
  6296. share/doc/qt5/qtlocation/qplaceidreply.html
  6297. share/doc/qt5/qtlocation/qplaceimage-members.html
  6298. share/doc/qt5/qtlocation/qplaceimage.html
  6299. share/doc/qt5/qtlocation/qplacemanager-members.html
  6300. share/doc/qt5/qtlocation/qplacemanager-obsolete.html
  6301. share/doc/qt5/qtlocation/qplacemanager.html
  6302. share/doc/qt5/qtlocation/qplacemanagerengine-members.html
  6303. share/doc/qt5/qtlocation/qplacemanagerengine-obsolete.html
  6304. share/doc/qt5/qtlocation/qplacemanagerengine.html
  6305. share/doc/qt5/qtlocation/qplacematchreply-members.html
  6306. share/doc/qt5/qtlocation/qplacematchreply-obsolete.html
  6307. share/doc/qt5/qtlocation/qplacematchreply.html
  6308. share/doc/qt5/qtlocation/qplacematchrequest-members.html
  6309. share/doc/qt5/qtlocation/qplacematchrequest.html
  6310. share/doc/qt5/qtlocation/qplaceproposedsearchresult-members.html
  6311. share/doc/qt5/qtlocation/qplaceproposedsearchresult.html
  6312. share/doc/qt5/qtlocation/qplaceratings-members.html
  6313. share/doc/qt5/qtlocation/qplaceratings.html
  6314. share/doc/qt5/qtlocation/qplacereply-members.html
  6315. share/doc/qt5/qtlocation/qplacereply-obsolete.html
  6316. share/doc/qt5/qtlocation/qplacereply.html
  6317. share/doc/qt5/qtlocation/qplaceresult-members.html
  6318. share/doc/qt5/qtlocation/qplaceresult.html
  6319. share/doc/qt5/qtlocation/qplacereview-members.html
  6320. share/doc/qt5/qtlocation/qplacereview.html
  6321. share/doc/qt5/qtlocation/qplacesearchreply-members.html
  6322. share/doc/qt5/qtlocation/qplacesearchreply-obsolete.html
  6323. share/doc/qt5/qtlocation/qplacesearchreply.html
  6324. share/doc/qt5/qtlocation/qplacesearchrequest-members.html
  6325. share/doc/qt5/qtlocation/qplacesearchrequest.html
  6326. share/doc/qt5/qtlocation/qplacesearchresult-members.html
  6327. share/doc/qt5/qtlocation/qplacesearchresult.html
  6328. share/doc/qt5/qtlocation/qplacesearchsuggestionreply-members.html
  6329. share/doc/qt5/qtlocation/qplacesearchsuggestionreply-obsolete.html
  6330. share/doc/qt5/qtlocation/qplacesearchsuggestionreply.html
  6331. share/doc/qt5/qtlocation/qplacesupplier-members.html
  6332. share/doc/qt5/qtlocation/qplacesupplier.html
  6333. share/doc/qt5/qtlocation/qplaceuser-members.html
  6334. share/doc/qt5/qtlocation/qplaceuser.html
  6335. share/doc/qt5/qtlocation/qt-labs-location-qmlmodule.html
  6336. share/doc/qt5/qtlocation/qtlocation-attribution-clip2tri.html
  6337. share/doc/qt5/qtlocation/qtlocation-attribution-clipper.html
  6338. share/doc/qt5/qtlocation/qtlocation-attribution-earcut.html
  6339. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-boost.html
  6340. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-css-color-parser.html
  6341. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-earcut.html
  6342. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojson.html
  6343. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geojsonvt.html
  6344. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-geometry.html
  6345. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-kdbush.html
  6346. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-libcxx.html
  6347. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-nunicode.html
  6348. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-parsedate.html
  6349. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-polylabel.html
  6350. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-protozero.html
  6351. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-rapidjson.html
  6352. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-shelfpack.html
  6353. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-supercluster.html
  6354. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-tao-tuple.html
  6355. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-unique-resource.html
  6356. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-variant.html
  6357. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-vectortile.html
  6358. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl-wagyu.html
  6359. share/doc/qt5/qtlocation/qtlocation-attribution-mapboxgl.html
  6360. share/doc/qt5/qtlocation/qtlocation-attribution-poly2tri.html
  6361. share/doc/qt5/qtlocation/qtlocation-changes.html
  6362. share/doc/qt5/qtlocation/qtlocation-cpp.html
  6363. share/doc/qt5/qtlocation/qtlocation-examples.html
  6364. share/doc/qt5/qtlocation/qtlocation-geoservices.html
  6365. share/doc/qt5/qtlocation/qtlocation-index.html
  6366. share/doc/qt5/qtlocation/qtlocation-itemview-transitions-example.html
  6367. share/doc/qt5/qtlocation/qtlocation-itemview-transitions-itemview-transitions-pro.html
  6368. share/doc/qt5/qtlocation/qtlocation-itemview-transitions-main-cpp.html
  6369. share/doc/qt5/qtlocation/qtlocation-itemview-transitions-main-qml.html
  6370. share/doc/qt5/qtlocation/qtlocation-itemview-transitions-oslolistmodel-qml.html
  6371. share/doc/qt5/qtlocation/qtlocation-mapviewer-example.html
  6372. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocode-qml.html
  6373. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-geocodeform-ui-qml.html
  6374. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-locale-qml.html
  6375. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-localeform-ui-qml.html
  6376. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-message-qml.html
  6377. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-messageform-ui-qml.html
  6378. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocode-qml.html
  6379. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-reversegeocodeform-ui-qml.html
  6380. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddress-qml.html
  6381. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routeaddressform-ui-qml.html
  6382. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinate-qml.html
  6383. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routecoordinateform-ui-qml.html
  6384. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelist-qml.html
  6385. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistdelegate-qml.html
  6386. share/doc/qt5/qtlocation/qtlocation-mapviewer-forms-routelistheader-qml.html
  6387. share/doc/qt5/qtlocation/qtlocation-mapviewer-helper-js.html
  6388. share/doc/qt5/qtlocation/qtlocation-mapviewer-main-cpp.html
  6389. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-circleitem-qml.html
  6390. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-imageitem-qml.html
  6391. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapcomponent-qml.html
  6392. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-mapsliders-qml.html
  6393. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-marker-qml.html
  6394. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-minimap-qml.html
  6395. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polygonitem-qml.html
  6396. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-polylineitem-qml.html
  6397. share/doc/qt5/qtlocation/qtlocation-mapviewer-map-rectangleitem-qml.html
  6398. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-pro.html
  6399. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qml.html
  6400. share/doc/qt5/qtlocation/qtlocation-mapviewer-mapviewer-qrc.html
  6401. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-itempopupmenu-qml.html
  6402. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mainmenu-qml.html
  6403. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-mappopupmenu-qml.html
  6404. share/doc/qt5/qtlocation/qtlocation-mapviewer-menus-markerpopupmenu-qml.html
  6405. share/doc/qt5/qtlocation/qtlocation-minimal-map-example.html
  6406. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-cpp.html
  6407. share/doc/qt5/qtlocation/qtlocation-minimal-map-main-qml.html
  6408. share/doc/qt5/qtlocation/qtlocation-minimal-map-minimal-map-pro.html
  6409. share/doc/qt5/qtlocation/qtlocation-minimal-map-qml-qrc.html
  6410. share/doc/qt5/qtlocation/qtlocation-module.html
  6411. share/doc/qt5/qtlocation/qtlocation-places-example.html
  6412. share/doc/qt5/qtlocation/qtlocation-places-forms-message-qml.html
  6413. share/doc/qt5/qtlocation/qtlocation-places-forms-messageform-ui-qml.html
  6414. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetails-qml.html
  6415. share/doc/qt5/qtlocation/qtlocation-places-forms-placedetailsform-ui-qml.html
  6416. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingbox-qml.html
  6417. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingboxform-ui-qml.html
  6418. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircle-qml.html
  6419. share/doc/qt5/qtlocation/qtlocation-places-forms-searchboundingcircleform-ui-qml.html
  6420. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenter-qml.html
  6421. share/doc/qt5/qtlocation/qtlocation-places-forms-searchcenterform-ui-qml.html
  6422. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptions-qml.html
  6423. share/doc/qt5/qtlocation/qtlocation-places-forms-searchoptionsform-ui-qml.html
  6424. share/doc/qt5/qtlocation/qtlocation-places-helper-js.html
  6425. share/doc/qt5/qtlocation/qtlocation-places-items-mainmenu-qml.html
  6426. share/doc/qt5/qtlocation/qtlocation-places-items-mapcomponent-qml.html
  6427. share/doc/qt5/qtlocation/qtlocation-places-items-searchbar-qml.html
  6428. share/doc/qt5/qtlocation/qtlocation-places-list-example.html
  6429. share/doc/qt5/qtlocation/qtlocation-places-list-main-cpp.html
  6430. share/doc/qt5/qtlocation/qtlocation-places-list-marker-qml.html
  6431. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-pro.html
  6432. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qml.html
  6433. share/doc/qt5/qtlocation/qtlocation-places-list-places-list-qrc.html
  6434. share/doc/qt5/qtlocation/qtlocation-places-main-cpp.html
  6435. share/doc/qt5/qtlocation/qtlocation-places-map-example.html
  6436. share/doc/qt5/qtlocation/qtlocation-places-map-main-cpp.html
  6437. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-pro.html
  6438. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qml.html
  6439. share/doc/qt5/qtlocation/qtlocation-places-map-places-map-qrc.html
  6440. share/doc/qt5/qtlocation/qtlocation-places-places-pro.html
  6441. share/doc/qt5/qtlocation/qtlocation-places-places-qml.html
  6442. share/doc/qt5/qtlocation/qtlocation-places-places-qrc.html
  6443. share/doc/qt5/qtlocation/qtlocation-places-views-categorydelegate-qml.html
  6444. share/doc/qt5/qtlocation/qtlocation-places-views-categoryview-qml.html
  6445. share/doc/qt5/qtlocation/qtlocation-places-views-editorialdelegate-qml.html
  6446. share/doc/qt5/qtlocation/qtlocation-places-views-editorialpage-qml.html
  6447. share/doc/qt5/qtlocation/qtlocation-places-views-editorialview-qml.html
  6448. share/doc/qt5/qtlocation/qtlocation-places-views-imageview-qml.html
  6449. share/doc/qt5/qtlocation/qtlocation-places-views-ratingview-qml.html
  6450. share/doc/qt5/qtlocation/qtlocation-places-views-reviewdelegate-qml.html
  6451. share/doc/qt5/qtlocation/qtlocation-places-views-reviewpage-qml.html
  6452. share/doc/qt5/qtlocation/qtlocation-places-views-reviewview-qml.html
  6453. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultdelegate-qml.html
  6454. share/doc/qt5/qtlocation/qtlocation-places-views-searchresultview-qml.html
  6455. share/doc/qt5/qtlocation/qtlocation-places-views-suggestionview-qml.html
  6456. share/doc/qt5/qtlocation/qtlocation-planespotter-example.html
  6457. share/doc/qt5/qtlocation/qtlocation-planespotter-main-cpp.html
  6458. share/doc/qt5/qtlocation/qtlocation-planespotter-plane-qml.html
  6459. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-pro.html
  6460. share/doc/qt5/qtlocation/qtlocation-planespotter-planespotter-qml.html
  6461. share/doc/qt5/qtlocation/qtlocation-planespotter-qml-qrc.html
  6462. share/doc/qt5/qtlocation/qtlocation-qmlmodule.html
  6463. share/doc/qt5/qtlocation/qtlocation.index
  6464. share/doc/qt5/qtlocation/qtlocation.qhp
  6465. share/doc/qt5/qtlocation/qtlocation.qhp.sha1
  6466. share/doc/qt5/qtlocation/qtlocation.tags
  6467. share/doc/qt5/qtlocation/style/offline-simple.css
  6468. share/doc/qt5/qtlocation/style/offline.css
  6469. share/doc/qt5/qtmacextras.qch
  6470. share/doc/qt5/qtmacextras/examples-manifest.xml
  6471. share/doc/qt5/qtmacextras/examples-qtmacextras.html
  6472. share/doc/qt5/qtmacextras/images/arrow_bc.png
  6473. share/doc/qt5/qtmacextras/images/bgrContent.png
  6474. share/doc/qt5/qtmacextras/images/btn_next.png
  6475. share/doc/qt5/qtmacextras/images/btn_prev.png
  6476. share/doc/qt5/qtmacextras/images/bullet_dn.png
  6477. share/doc/qt5/qtmacextras/images/bullet_sq.png
  6478. share/doc/qt5/qtmacextras/images/home.png
  6479. share/doc/qt5/qtmacextras/images/ico_note.png
  6480. share/doc/qt5/qtmacextras/images/ico_note_attention.png
  6481. share/doc/qt5/qtmacextras/images/ico_out.png
  6482. share/doc/qt5/qtmacextras/images/logo.png
  6483. share/doc/qt5/qtmacextras/images/used-in-examples/macfunctions/qtlogo.png
  6484. share/doc/qt5/qtmacextras/qmacpasteboardmime-members.html
  6485. share/doc/qt5/qtmacextras/qmacpasteboardmime.html
  6486. share/doc/qt5/qtmacextras/qmactoolbar-members.html
  6487. share/doc/qt5/qtmacextras/qmactoolbar-obsolete.html
  6488. share/doc/qt5/qtmacextras/qmactoolbar.html
  6489. share/doc/qt5/qtmacextras/qmactoolbaritem-members.html
  6490. share/doc/qt5/qtmacextras/qmactoolbaritem-obsolete.html
  6491. share/doc/qt5/qtmacextras/qmactoolbaritem.html
  6492. share/doc/qt5/qtmacextras/qtmac-obsolete.html
  6493. share/doc/qt5/qtmacextras/qtmac.html
  6494. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-embeddedqwindow-pro.html
  6495. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-example.html
  6496. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-cpp.html
  6497. share/doc/qt5/qtmacextras/qtmacextras-embeddedqwindow-window-h.html
  6498. share/doc/qt5/qtmacextras/qtmacextras-index.html
  6499. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-example.html
  6500. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-pro.html
  6501. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-macfunctions-qrc.html
  6502. share/doc/qt5/qtmacextras/qtmacextras-macfunctions-main-cpp.html
  6503. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-example.html
  6504. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-macpasteboardmime-pro.html
  6505. share/doc/qt5/qtmacextras/qtmacextras-macpasteboardmime-main-cpp.html
  6506. share/doc/qt5/qtmacextras/qtmacextras-module.html
  6507. share/doc/qt5/qtmacextras/qtmacextras.index
  6508. share/doc/qt5/qtmacextras/qtmacextras.qhp
  6509. share/doc/qt5/qtmacextras/qtmacextras.qhp.sha1
  6510. share/doc/qt5/qtmacextras/style/offline-simple.css
  6511. share/doc/qt5/qtmacextras/style/offline.css
  6512. share/doc/qt5/qtmultimedia.qch
  6513. share/doc/qt5/qtmultimedia/audiooverview.html
  6514. share/doc/qt5/qtmultimedia/cameraoverview.html
  6515. share/doc/qt5/qtmultimedia/changes.html
  6516. share/doc/qt5/qtmultimedia/examples-manifest.xml
  6517. share/doc/qt5/qtmultimedia/images/arrow_bc.png
  6518. share/doc/qt5/qtmultimedia/images/audiodevices.png
  6519. share/doc/qt5/qtmultimedia/images/audioinput-example.png
  6520. share/doc/qt5/qtmultimedia/images/audiooutput-example.png
  6521. share/doc/qt5/qtmultimedia/images/audiorecorder.png
  6522. share/doc/qt5/qtmultimedia/images/bgrContent.png
  6523. share/doc/qt5/qtmultimedia/images/btn_next.png
  6524. share/doc/qt5/qtmultimedia/images/btn_prev.png
  6525. share/doc/qt5/qtmultimedia/images/bullet_dn.png
  6526. share/doc/qt5/qtmultimedia/images/bullet_sq.png
  6527. share/doc/qt5/qtmultimedia/images/camera-example.png
  6528. share/doc/qt5/qtmultimedia/images/declarative-radio-example.png
  6529. share/doc/qt5/qtmultimedia/images/home.png
  6530. share/doc/qt5/qtmultimedia/images/ico_note.png
  6531. share/doc/qt5/qtmultimedia/images/ico_note_attention.png
  6532. share/doc/qt5/qtmultimedia/images/ico_out.png
  6533. share/doc/qt5/qtmultimedia/images/logo.png
  6534. share/doc/qt5/qtmultimedia/images/mediaplayerex.jpg
  6535. share/doc/qt5/qtmultimedia/images/qml-camera.png
  6536. share/doc/qt5/qtmultimedia/images/qmlvideo-menu.jpg
  6537. share/doc/qt5/qtmultimedia/images/qmlvideo-overlay.jpg
  6538. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-glow.jpg
  6539. share/doc/qt5/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
  6540. share/doc/qt5/qtmultimedia/images/qmlvideofx-effects-menu.jpg
  6541. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
  6542. share/doc/qt5/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
  6543. share/doc/qt5/qtmultimedia/images/radio-example.png
  6544. share/doc/qt5/qtmultimedia/images/spectrum-demo.png
  6545. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_auto_mode.png
  6546. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_camera_setting.png
  6547. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_auto.png
  6548. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_fill.png
  6549. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_off.png
  6550. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_flash_redeye.png
  6551. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_cloudy.png
  6552. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_flourescent.png
  6553. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_incandescent.png
  6554. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/camera_white_balance_sunny.png
  6555. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/declarative-camera/images/toolbutton.png
  6556. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/record.png
  6557. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/spectrum/app/images/settings.png
  6558. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/folder.png
  6559. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/leaves.jpg
  6560. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/images/up.png
  6561. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideo/qmlvideo.png
  6562. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Dropdown_arrows.png
  6563. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_bar.png
  6564. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Slider_handle.png
  6565. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_Top.png
  6566. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/Triangle_bottom.png
  6567. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_BackArrow.png
  6568. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Folder.png
  6569. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/icon_Menu.png
  6570. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/images/qt-logo.png
  6571. share/doc/qt5/qtmultimedia/images/used-in-examples/multimedia/video/qmlvideofx/qmlvideofx.png
  6572. share/doc/qt5/qtmultimedia/images/video-qml-paint-rate.png
  6573. share/doc/qt5/qtmultimedia/images/video-videographicsitem.png
  6574. share/doc/qt5/qtmultimedia/images/video-videowidget.png
  6575. share/doc/qt5/qtmultimedia/multimedia-examples.html
  6576. share/doc/qt5/qtmultimedia/multimediabackend.html
  6577. share/doc/qt5/qtmultimedia/multimediaoverview.html
  6578. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo-members.html
  6579. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo-obsolete.html
  6580. share/doc/qt5/qtmultimedia/qabstractaudiodeviceinfo.html
  6581. share/doc/qt5/qtmultimedia/qabstractaudioinput-members.html
  6582. share/doc/qt5/qtmultimedia/qabstractaudioinput-obsolete.html
  6583. share/doc/qt5/qtmultimedia/qabstractaudioinput.html
  6584. share/doc/qt5/qtmultimedia/qabstractaudiooutput-members.html
  6585. share/doc/qt5/qtmultimedia/qabstractaudiooutput-obsolete.html
  6586. share/doc/qt5/qtmultimedia/qabstractaudiooutput.html
  6587. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer-members.html
  6588. share/doc/qt5/qtmultimedia/qabstractplanarvideobuffer.html
  6589. share/doc/qt5/qtmultimedia/qabstractvideobuffer-members.html
  6590. share/doc/qt5/qtmultimedia/qabstractvideobuffer.html
  6591. share/doc/qt5/qtmultimedia/qabstractvideofilter-members.html
  6592. share/doc/qt5/qtmultimedia/qabstractvideofilter-obsolete.html
  6593. share/doc/qt5/qtmultimedia/qabstractvideofilter.html
  6594. share/doc/qt5/qtmultimedia/qabstractvideosurface-members.html
  6595. share/doc/qt5/qtmultimedia/qabstractvideosurface-obsolete.html
  6596. share/doc/qt5/qtmultimedia/qabstractvideosurface.html
  6597. share/doc/qt5/qtmultimedia/qaudio.html
  6598. share/doc/qt5/qtmultimedia/qaudiobuffer-members.html
  6599. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe-members.html
  6600. share/doc/qt5/qtmultimedia/qaudiobuffer-stereoframe.html
  6601. share/doc/qt5/qtmultimedia/qaudiobuffer.html
  6602. share/doc/qt5/qtmultimedia/qaudiodecoder-members.html
  6603. share/doc/qt5/qtmultimedia/qaudiodecoder-obsolete.html
  6604. share/doc/qt5/qtmultimedia/qaudiodecoder.html
  6605. share/doc/qt5/qtmultimedia/qaudiodecodercontrol-members.html
  6606. share/doc/qt5/qtmultimedia/qaudiodecodercontrol-obsolete.html
  6607. share/doc/qt5/qtmultimedia/qaudiodecodercontrol.html
  6608. share/doc/qt5/qtmultimedia/qaudiodeviceinfo-members.html
  6609. share/doc/qt5/qtmultimedia/qaudiodeviceinfo.html
  6610. share/doc/qt5/qtmultimedia/qaudioencodersettings-members.html
  6611. share/doc/qt5/qtmultimedia/qaudioencodersettings.html
  6612. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol-members.html
  6613. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol-obsolete.html
  6614. share/doc/qt5/qtmultimedia/qaudioencodersettingscontrol.html
  6615. share/doc/qt5/qtmultimedia/qaudioformat-members.html
  6616. share/doc/qt5/qtmultimedia/qaudioformat.html
  6617. share/doc/qt5/qtmultimedia/qaudioinput-members.html
  6618. share/doc/qt5/qtmultimedia/qaudioinput-obsolete.html
  6619. share/doc/qt5/qtmultimedia/qaudioinput.html
  6620. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol-members.html
  6621. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol-obsolete.html
  6622. share/doc/qt5/qtmultimedia/qaudioinputselectorcontrol.html
  6623. share/doc/qt5/qtmultimedia/qaudiooutput-members.html
  6624. share/doc/qt5/qtmultimedia/qaudiooutput-obsolete.html
  6625. share/doc/qt5/qtmultimedia/qaudiooutput.html
  6626. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol-members.html
  6627. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol-obsolete.html
  6628. share/doc/qt5/qtmultimedia/qaudiooutputselectorcontrol.html
  6629. share/doc/qt5/qtmultimedia/qaudioprobe-members.html
  6630. share/doc/qt5/qtmultimedia/qaudioprobe-obsolete.html
  6631. share/doc/qt5/qtmultimedia/qaudioprobe.html
  6632. share/doc/qt5/qtmultimedia/qaudiorecorder-members.html
  6633. share/doc/qt5/qtmultimedia/qaudiorecorder-obsolete.html
  6634. share/doc/qt5/qtmultimedia/qaudiorecorder.html
  6635. share/doc/qt5/qtmultimedia/qaudiorolecontrol-members.html
  6636. share/doc/qt5/qtmultimedia/qaudiorolecontrol-obsolete.html
  6637. share/doc/qt5/qtmultimedia/qaudiorolecontrol.html
  6638. share/doc/qt5/qtmultimedia/qaudiosystemplugin-members.html
  6639. share/doc/qt5/qtmultimedia/qaudiosystemplugin-obsolete.html
  6640. share/doc/qt5/qtmultimedia/qaudiosystemplugin.html
  6641. share/doc/qt5/qtmultimedia/qcamera-frameraterange-members.html
  6642. share/doc/qt5/qtmultimedia/qcamera-frameraterange.html
  6643. share/doc/qt5/qtmultimedia/qcamera-members.html
  6644. share/doc/qt5/qtmultimedia/qcamera-obsolete.html
  6645. share/doc/qt5/qtmultimedia/qcamera.html
  6646. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol-members.html
  6647. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol-obsolete.html
  6648. share/doc/qt5/qtmultimedia/qcameracapturebufferformatcontrol.html
  6649. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol-members.html
  6650. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol-obsolete.html
  6651. share/doc/qt5/qtmultimedia/qcameracapturedestinationcontrol.html
  6652. share/doc/qt5/qtmultimedia/qcameracontrol-members.html
  6653. share/doc/qt5/qtmultimedia/qcameracontrol-obsolete.html
  6654. share/doc/qt5/qtmultimedia/qcameracontrol.html
  6655. share/doc/qt5/qtmultimedia/qcameraexposure-members.html
  6656. share/doc/qt5/qtmultimedia/qcameraexposure-obsolete.html
  6657. share/doc/qt5/qtmultimedia/qcameraexposure.html
  6658. share/doc/qt5/qtmultimedia/qcameraexposurecontrol-members.html
  6659. share/doc/qt5/qtmultimedia/qcameraexposurecontrol-obsolete.html
  6660. share/doc/qt5/qtmultimedia/qcameraexposurecontrol.html
  6661. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol-members.html
  6662. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol-obsolete.html
  6663. share/doc/qt5/qtmultimedia/qcamerafeedbackcontrol.html
  6664. share/doc/qt5/qtmultimedia/qcameraflashcontrol-members.html
  6665. share/doc/qt5/qtmultimedia/qcameraflashcontrol-obsolete.html
  6666. share/doc/qt5/qtmultimedia/qcameraflashcontrol.html
  6667. share/doc/qt5/qtmultimedia/qcamerafocus-members.html
  6668. share/doc/qt5/qtmultimedia/qcamerafocus-obsolete.html
  6669. share/doc/qt5/qtmultimedia/qcamerafocus.html
  6670. share/doc/qt5/qtmultimedia/qcamerafocuscontrol-members.html
  6671. share/doc/qt5/qtmultimedia/qcamerafocuscontrol-obsolete.html
  6672. share/doc/qt5/qtmultimedia/qcamerafocuscontrol.html
  6673. share/doc/qt5/qtmultimedia/qcamerafocuszone-members.html
  6674. share/doc/qt5/qtmultimedia/qcamerafocuszone.html
  6675. share/doc/qt5/qtmultimedia/qcameraimagecapture-members.html
  6676. share/doc/qt5/qtmultimedia/qcameraimagecapture-obsolete.html
  6677. share/doc/qt5/qtmultimedia/qcameraimagecapture.html
  6678. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol-members.html
  6679. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol-obsolete.html
  6680. share/doc/qt5/qtmultimedia/qcameraimagecapturecontrol.html
  6681. share/doc/qt5/qtmultimedia/qcameraimageprocessing-members.html
  6682. share/doc/qt5/qtmultimedia/qcameraimageprocessing-obsolete.html
  6683. share/doc/qt5/qtmultimedia/qcameraimageprocessing.html
  6684. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol-members.html
  6685. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol-obsolete.html
  6686. share/doc/qt5/qtmultimedia/qcameraimageprocessingcontrol.html
  6687. share/doc/qt5/qtmultimedia/qcamerainfo-members.html
  6688. share/doc/qt5/qtmultimedia/qcamerainfo.html
  6689. share/doc/qt5/qtmultimedia/qcamerainfocontrol-members.html
  6690. share/doc/qt5/qtmultimedia/qcamerainfocontrol-obsolete.html
  6691. share/doc/qt5/qtmultimedia/qcamerainfocontrol.html
  6692. share/doc/qt5/qtmultimedia/qcameralockscontrol-members.html
  6693. share/doc/qt5/qtmultimedia/qcameralockscontrol-obsolete.html
  6694. share/doc/qt5/qtmultimedia/qcameralockscontrol.html
  6695. share/doc/qt5/qtmultimedia/qcameraviewfinder-members.html
  6696. share/doc/qt5/qtmultimedia/qcameraviewfinder-obsolete.html
  6697. share/doc/qt5/qtmultimedia/qcameraviewfinder.html
  6698. share/doc/qt5/qtmultimedia/qcameraviewfindersettings-members.html
  6699. share/doc/qt5/qtmultimedia/qcameraviewfindersettings.html
  6700. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol-members.html
  6701. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol-obsolete.html
  6702. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol.html
  6703. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
  6704. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2-obsolete.html
  6705. share/doc/qt5/qtmultimedia/qcameraviewfindersettingscontrol2.html
  6706. share/doc/qt5/qtmultimedia/qcamerazoomcontrol-members.html
  6707. share/doc/qt5/qtmultimedia/qcamerazoomcontrol-obsolete.html
  6708. share/doc/qt5/qtmultimedia/qcamerazoomcontrol.html
  6709. share/doc/qt5/qtmultimedia/qcustomaudiorolecontrol-members.html
  6710. share/doc/qt5/qtmultimedia/qcustomaudiorolecontrol-obsolete.html
  6711. share/doc/qt5/qtmultimedia/qcustomaudiorolecontrol.html
  6712. share/doc/qt5/qtmultimedia/qgraphicsvideoitem-members.html
  6713. share/doc/qt5/qtmultimedia/qgraphicsvideoitem-obsolete.html
  6714. share/doc/qt5/qtmultimedia/qgraphicsvideoitem.html
  6715. share/doc/qt5/qtmultimedia/qgstutils-camerainfo-members.html
  6716. share/doc/qt5/qtmultimedia/qgstutils-camerainfo.html
  6717. share/doc/qt5/qtmultimedia/qgstutils-sub-qtmultimedia.html
  6718. share/doc/qt5/qtmultimedia/qimageencodercontrol-members.html
  6719. share/doc/qt5/qtmultimedia/qimageencodercontrol-obsolete.html
  6720. share/doc/qt5/qtmultimedia/qimageencodercontrol.html
  6721. share/doc/qt5/qtmultimedia/qimageencodersettings-members.html
  6722. share/doc/qt5/qtmultimedia/qimageencodersettings.html
  6723. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol-members.html
  6724. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol-obsolete.html
  6725. share/doc/qt5/qtmultimedia/qmediaaudioprobecontrol.html
  6726. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol-members.html
  6727. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol-obsolete.html
  6728. share/doc/qt5/qtmultimedia/qmediaavailabilitycontrol.html
  6729. share/doc/qt5/qtmultimedia/qmediabindableinterface-members.html
  6730. share/doc/qt5/qtmultimedia/qmediabindableinterface.html
  6731. share/doc/qt5/qtmultimedia/qmediacontainercontrol-members.html
  6732. share/doc/qt5/qtmultimedia/qmediacontainercontrol-obsolete.html
  6733. share/doc/qt5/qtmultimedia/qmediacontainercontrol.html
  6734. share/doc/qt5/qtmultimedia/qmediacontent-members.html
  6735. share/doc/qt5/qtmultimedia/qmediacontent.html
  6736. share/doc/qt5/qtmultimedia/qmediacontrol-members.html
  6737. share/doc/qt5/qtmultimedia/qmediacontrol-obsolete.html
  6738. share/doc/qt5/qtmultimedia/qmediacontrol.html
  6739. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol-members.html
  6740. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol-obsolete.html
  6741. share/doc/qt5/qtmultimedia/qmediagaplessplaybackcontrol.html
  6742. share/doc/qt5/qtmultimedia/qmediametadata.html
  6743. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol-members.html
  6744. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol-obsolete.html
  6745. share/doc/qt5/qtmultimedia/qmedianetworkaccesscontrol.html
  6746. share/doc/qt5/qtmultimedia/qmediaobject-members.html
  6747. share/doc/qt5/qtmultimedia/qmediaobject-obsolete.html
  6748. share/doc/qt5/qtmultimedia/qmediaobject.html
  6749. share/doc/qt5/qtmultimedia/qmediaplayer-members.html
  6750. share/doc/qt5/qtmultimedia/qmediaplayer-obsolete.html
  6751. share/doc/qt5/qtmultimedia/qmediaplayer.html
  6752. share/doc/qt5/qtmultimedia/qmediaplayercontrol-members.html
  6753. share/doc/qt5/qtmultimedia/qmediaplayercontrol-obsolete.html
  6754. share/doc/qt5/qtmultimedia/qmediaplayercontrol.html
  6755. share/doc/qt5/qtmultimedia/qmediaplaylist-members.html
  6756. share/doc/qt5/qtmultimedia/qmediaplaylist-obsolete.html
  6757. share/doc/qt5/qtmultimedia/qmediaplaylist.html
  6758. share/doc/qt5/qtmultimedia/qmediarecorder-members.html
  6759. share/doc/qt5/qtmultimedia/qmediarecorder-obsolete.html
  6760. share/doc/qt5/qtmultimedia/qmediarecorder.html
  6761. share/doc/qt5/qtmultimedia/qmediarecordercontrol-members.html
  6762. share/doc/qt5/qtmultimedia/qmediarecordercontrol-obsolete.html
  6763. share/doc/qt5/qtmultimedia/qmediarecordercontrol.html
  6764. share/doc/qt5/qtmultimedia/qmediaresource-members.html
  6765. share/doc/qt5/qtmultimedia/qmediaresource.html
  6766. share/doc/qt5/qtmultimedia/qmediaservice-members.html
  6767. share/doc/qt5/qtmultimedia/qmediaservice-obsolete.html
  6768. share/doc/qt5/qtmultimedia/qmediaservice.html
  6769. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface-members.html
  6770. share/doc/qt5/qtmultimedia/qmediaservicecamerainfointerface.html
  6771. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
  6772. share/doc/qt5/qtmultimedia/qmediaservicedefaultdeviceinterface.html
  6773. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface-members.html
  6774. share/doc/qt5/qtmultimedia/qmediaservicefeaturesinterface.html
  6775. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin-members.html
  6776. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin-obsolete.html
  6777. share/doc/qt5/qtmultimedia/qmediaserviceproviderplugin.html
  6778. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
  6779. share/doc/qt5/qtmultimedia/qmediaservicesupporteddevicesinterface.html
  6780. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
  6781. share/doc/qt5/qtmultimedia/qmediaservicesupportedformatsinterface.html
  6782. share/doc/qt5/qtmultimedia/qmediastreamscontrol-members.html
  6783. share/doc/qt5/qtmultimedia/qmediastreamscontrol-obsolete.html
  6784. share/doc/qt5/qtmultimedia/qmediastreamscontrol.html
  6785. share/doc/qt5/qtmultimedia/qmediatimeinterval-members.html
  6786. share/doc/qt5/qtmultimedia/qmediatimeinterval.html
  6787. share/doc/qt5/qtmultimedia/qmediatimerange-members.html
  6788. share/doc/qt5/qtmultimedia/qmediatimerange.html
  6789. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol-members.html
  6790. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol-obsolete.html
  6791. share/doc/qt5/qtmultimedia/qmediavideoprobecontrol.html
  6792. share/doc/qt5/qtmultimedia/qmetadatareadercontrol-members.html
  6793. share/doc/qt5/qtmultimedia/qmetadatareadercontrol-obsolete.html
  6794. share/doc/qt5/qtmultimedia/qmetadatareadercontrol.html
  6795. share/doc/qt5/qtmultimedia/qmetadatawritercontrol-members.html
  6796. share/doc/qt5/qtmultimedia/qmetadatawritercontrol-obsolete.html
  6797. share/doc/qt5/qtmultimedia/qmetadatawritercontrol.html
  6798. share/doc/qt5/qtmultimedia/qml-multimedia.html
  6799. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
  6800. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
  6801. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
  6802. share/doc/qt5/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
  6803. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
  6804. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiocategory.html
  6805. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine-members.html
  6806. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audioengine.html
  6807. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
  6808. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiolistener.html
  6809. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample-members.html
  6810. share/doc/qt5/qtmultimedia/qml-qtaudioengine-audiosample.html
  6811. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation-members.html
  6812. share/doc/qt5/qtmultimedia/qml-qtaudioengine-playvariation.html
  6813. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound-members.html
  6814. share/doc/qt5/qtmultimedia/qml-qtaudioengine-sound.html
  6815. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
  6816. share/doc/qt5/qtmultimedia/qml-qtaudioengine-soundinstance.html
  6817. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio-members.html
  6818. share/doc/qt5/qtmultimedia/qml-qtmultimedia-audio.html
  6819. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera-members.html
  6820. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camera.html
  6821. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
  6822. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameracapture.html
  6823. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
  6824. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraexposure.html
  6825. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
  6826. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraflash.html
  6827. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
  6828. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerafocus.html
  6829. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
  6830. share/doc/qt5/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
  6831. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
  6832. share/doc/qt5/qtmultimedia/qml-qtmultimedia-camerarecorder.html
  6833. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
  6834. share/doc/qt5/qtmultimedia/qml-qtmultimedia-mediaplayer.html
  6835. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist-members.html
  6836. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlist.html
  6837. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
  6838. share/doc/qt5/qtmultimedia/qml-qtmultimedia-playlistitem.html
  6839. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
  6840. share/doc/qt5/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
  6841. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio-members.html
  6842. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radio.html
  6843. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata-members.html
  6844. share/doc/qt5/qtmultimedia/qml-qtmultimedia-radiodata.html
  6845. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
  6846. share/doc/qt5/qtmultimedia/qml-qtmultimedia-soundeffect.html
  6847. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch-members.html
  6848. share/doc/qt5/qtmultimedia/qml-qtmultimedia-torch.html
  6849. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video-members.html
  6850. share/doc/qt5/qtmultimedia/qml-qtmultimedia-video.html
  6851. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput-members.html
  6852. share/doc/qt5/qtmultimedia/qml-qtmultimedia-videooutput.html
  6853. share/doc/qt5/qtmultimedia/qmultimedia.html
  6854. share/doc/qt5/qtmultimedia/qradiodata-members.html
  6855. share/doc/qt5/qtmultimedia/qradiodata-obsolete.html
  6856. share/doc/qt5/qtmultimedia/qradiodata.html
  6857. share/doc/qt5/qtmultimedia/qradiodatacontrol-members.html
  6858. share/doc/qt5/qtmultimedia/qradiodatacontrol-obsolete.html
  6859. share/doc/qt5/qtmultimedia/qradiodatacontrol.html
  6860. share/doc/qt5/qtmultimedia/qradiotuner-members.html
  6861. share/doc/qt5/qtmultimedia/qradiotuner-obsolete.html
  6862. share/doc/qt5/qtmultimedia/qradiotuner.html
  6863. share/doc/qt5/qtmultimedia/qradiotunercontrol-members.html
  6864. share/doc/qt5/qtmultimedia/qradiotunercontrol-obsolete.html
  6865. share/doc/qt5/qtmultimedia/qradiotunercontrol.html
  6866. share/doc/qt5/qtmultimedia/qsound-members.html
  6867. share/doc/qt5/qtmultimedia/qsound-obsolete.html
  6868. share/doc/qt5/qtmultimedia/qsound.html
  6869. share/doc/qt5/qtmultimedia/qsoundeffect-members.html
  6870. share/doc/qt5/qtmultimedia/qsoundeffect-obsolete.html
  6871. share/doc/qt5/qtmultimedia/qsoundeffect.html
  6872. share/doc/qt5/qtmultimedia/qtaudioengine-qmlmodule.html
  6873. share/doc/qt5/qtmultimedia/qtmultimedia-index.html
  6874. share/doc/qt5/qtmultimedia/qtmultimedia-ios.html
  6875. share/doc/qt5/qtmultimedia/qtmultimedia-module.html
  6876. share/doc/qt5/qtmultimedia/qtmultimedia-modules.html
  6877. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-cpp.html
  6878. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-h.html
  6879. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevices-pro.html
  6880. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-audiodevicesbase-ui.html
  6881. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
  6882. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiodevices-main-cpp.html
  6883. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-audioengine-pro.html
  6884. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
  6885. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qml.html
  6886. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-audioengine-qmlproject.html
  6887. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioengine-qml-content-myaudioengine-qml.html
  6888. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-cpp.html
  6889. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-h.html
  6890. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-audioinput-pro.html
  6891. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
  6892. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audioinput-main-cpp.html
  6893. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-cpp.html
  6894. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-h.html
  6895. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-audiooutput-pro.html
  6896. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
  6897. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiooutput-main-cpp.html
  6898. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-cpp.html
  6899. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiolevel-h.html
  6900. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-cpp.html
  6901. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-h.html
  6902. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-pro.html
  6903. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-audiorecorder-ui.html
  6904. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
  6905. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-audiorecorder-main-cpp.html
  6906. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerabutton-qml.html
  6907. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistbutton-qml.html
  6908. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-cameralistpopup-qml.html
  6909. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertybutton-qml.html
  6910. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-camerapropertypopup-qml.html
  6911. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-pro.html
  6912. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qml.html
  6913. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qmlproject.html
  6914. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-declarative-camera-qrc.html
  6915. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
  6916. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-focusbutton-qml.html
  6917. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photocapturecontrols-qml.html
  6918. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-photopreview-qml.html
  6919. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-popup-qml.html
  6920. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-qmlcamera-cpp.html
  6921. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videocapturecontrols-qml.html
  6922. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-videopreview-qml.html
  6923. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-camera-zoomcontrol-qml.html
  6924. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-button-qml.html
  6925. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-pro.html
  6926. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-declarative-radio-qrc.html
  6927. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
  6928. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-main-cpp.html
  6929. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-declarative-radio-view-qml.html
  6930. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-array-h.html
  6931. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-def-h.html
  6932. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-dynarray-h.html
  6933. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-h.html
  6934. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-pro.html
  6935. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-cpp.html
  6936. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftreal-wrapper-h.html
  6937. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlen-h.html
  6938. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealfixlenparam-h.html
  6939. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassdirect-h.html
  6940. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealpassinverse-h.html
  6941. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealselect-h.html
  6942. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-fftrealusetrigo-h.html
  6943. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-oscsincos-h.html
  6944. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-cpp.html
  6945. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-clockcyclecounter-h.html
  6946. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-def-h.html
  6947. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-fnc-h.html
  6948. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-int64-h.html
  6949. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-cpp.html
  6950. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-stopwatch-stopwatch-h.html
  6951. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-cpp.html
  6952. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-fnc-h.html
  6953. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-test-settings-h.html
  6954. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testaccuracy-h.html
  6955. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelperfixlen-h.html
  6956. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testhelpernormal-h.html
  6957. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testspeed-h.html
  6958. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-3rdparty-fftreal-testwhitenoisegen-h.html
  6959. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-app-pro.html
  6960. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-cpp.html
  6961. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-engine-h.html
  6962. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-cpp.html
  6963. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-frequencyspectrum-h.html
  6964. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-cpp.html
  6965. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-levelmeter-h.html
  6966. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-main-cpp.html
  6967. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-cpp.html
  6968. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-mainwidget-h.html
  6969. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-cpp.html
  6970. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-progressbar-h.html
  6971. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-cpp.html
  6972. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-settingsdialog-h.html
  6973. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-cpp.html
  6974. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrograph-h.html
  6975. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-h.html
  6976. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrum-qrc.html
  6977. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-cpp.html
  6978. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-spectrumanalyser-h.html
  6979. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-cpp.html
  6980. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegenerator-h.html
  6981. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-cpp.html
  6982. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-tonegeneratordialog-h.html
  6983. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-cpp.html
  6984. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-utils-h.html
  6985. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-cpp.html
  6986. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-waveform-h.html
  6987. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-cpp.html
  6988. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-app-wavfile-h.html
  6989. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
  6990. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-spectrum-spectrum-pro.html
  6991. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
  6992. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-main-cpp.html
  6993. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-button-qml.html
  6994. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerabasic-qml.html
  6995. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradrag-qml.html
  6996. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameradummy-qml.html
  6997. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreen-qml.html
  6998. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerafullscreeninverted-qml.html
  6999. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraitem-qml.html
  7000. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameramove-qml.html
  7001. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraoverlay-qml.html
  7002. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraresize-qml.html
  7003. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-camerarotate-qml.html
  7004. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-cameraspin-qml.html
  7005. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-content-qml.html
  7006. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-errordialog-qml.html
  7007. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-filebrowser-qml.html
  7008. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-main-qml.html
  7009. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scene-qml.html
  7010. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenebasic-qml.html
  7011. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenedrag-qml.html
  7012. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreen-qml.html
  7013. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenefullscreeninverted-qml.html
  7014. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemove-qml.html
  7015. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenemulti-qml.html
  7016. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneoverlay-qml.html
  7017. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneresize-qml.html
  7018. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenerotate-qml.html
  7019. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-sceneselectionpanel-qml.html
  7020. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-scenespin-qml.html
  7021. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-seekcontrol-qml.html
  7022. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videobasic-qml.html
  7023. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodrag-qml.html
  7024. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videodummy-qml.html
  7025. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofillmode-qml.html
  7026. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreen-qml.html
  7027. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videofullscreeninverted-qml.html
  7028. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoitem-qml.html
  7029. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videometadata-qml.html
  7030. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videomove-qml.html
  7031. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videooverlay-qml.html
  7032. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoplaybackrate-qml.html
  7033. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoresize-qml.html
  7034. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videorotate-qml.html
  7035. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videoseek-qml.html
  7036. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qml-qmlvideo-videospin-qml.html
  7037. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-pro.html
  7038. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-qrc.html
  7039. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-qmlvideo-svg.html
  7040. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-trace-h.html
  7041. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
  7042. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-cpp.html
  7043. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-filereader-h.html
  7044. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-main-cpp.html
  7045. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-button-qml.html
  7046. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-content-qml.html
  7047. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentcamera-qml.html
  7048. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentimage-qml.html
  7049. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-contentvideo-qml.html
  7050. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-curtain-qml.html
  7051. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-divider-qml.html
  7052. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effect-qml.html
  7053. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectbillboard-qml.html
  7054. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectblackandwhite-qml.html
  7055. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectemboss-qml.html
  7056. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectgaussianblur-qml.html
  7057. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectglow-qml.html
  7058. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectisolate-qml.html
  7059. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectmagnify-qml.html
  7060. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpagecurl-qml.html
  7061. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpassthrough-qml.html
  7062. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectpixelate-qml.html
  7063. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectposterize-qml.html
  7064. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectripple-qml.html
  7065. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectselectionlist-qml.html
  7066. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsepia-qml.html
  7067. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsharpen-qml.html
  7068. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectshockwave-qml.html
  7069. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectsobeledgedetection1-qml.html
  7070. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttiltshift-qml.html
  7071. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effecttoon-qml.html
  7072. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectvignette-qml.html
  7073. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwarhol-qml.html
  7074. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-effectwobble-qml.html
  7075. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-filebrowser-qml.html
  7076. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-fileopen-qml.html
  7077. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-hintedmousearea-qml.html
  7078. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-main-qml.html
  7079. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-parameterpanel-qml.html
  7080. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qml-qmlvideofx-slider-qml.html
  7081. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-cpp.html
  7082. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlapplicationviewer-qmlapplicationviewer-h.html
  7083. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-pro.html
  7084. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-qrc.html
  7085. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-qmlvideofx-svg.html
  7086. share/doc/qt5/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-trace-h.html
  7087. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-cpp.html
  7088. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-h.html
  7089. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-pro.html
  7090. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-qrc.html
  7091. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-camera-ui.html
  7092. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
  7093. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-images-shutter-svg.html
  7094. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-cpp.html
  7095. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-h.html
  7096. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-imagesettings-ui.html
  7097. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-main-cpp.html
  7098. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-cpp.html
  7099. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-h.html
  7100. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-camera-videosettings-ui.html
  7101. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
  7102. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-cpp.html
  7103. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-histogramwidget-h.html
  7104. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-main-cpp.html
  7105. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-cpp.html
  7106. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-h.html
  7107. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-player-pro.html
  7108. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-cpp.html
  7109. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playercontrols-h.html
  7110. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-cpp.html
  7111. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-playlistmodel-h.html
  7112. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-cpp.html
  7113. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-player-videowidget-h.html
  7114. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
  7115. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-main-cpp.html
  7116. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videographicsitem-pro.html
  7117. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-cpp.html
  7118. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-videoplayer-h.html
  7119. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
  7120. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-main-cpp.html
  7121. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-cpp.html
  7122. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videoplayer-h.html
  7123. share/doc/qt5/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-videowidget-pro.html
  7124. share/doc/qt5/qtmultimedia/qtmultimedia-qmlmodule.html
  7125. share/doc/qt5/qtmultimedia/qtmultimedia-windows.html
  7126. share/doc/qt5/qtmultimedia/qtmultimedia.index
  7127. share/doc/qt5/qtmultimedia/qtmultimedia.qhp
  7128. share/doc/qt5/qtmultimedia/qtmultimedia.qhp.sha1
  7129. share/doc/qt5/qtmultimedia/qtmultimediawidgets-index.html
  7130. share/doc/qt5/qtmultimedia/qtmultimediawidgets-module.html
  7131. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol-members.html
  7132. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol-obsolete.html
  7133. share/doc/qt5/qtmultimedia/qvideodeviceselectorcontrol.html
  7134. share/doc/qt5/qtmultimedia/qvideoencodersettings-members.html
  7135. share/doc/qt5/qtmultimedia/qvideoencodersettings.html
  7136. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol-members.html
  7137. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol-obsolete.html
  7138. share/doc/qt5/qtmultimedia/qvideoencodersettingscontrol.html
  7139. share/doc/qt5/qtmultimedia/qvideofilterrunnable-members.html
  7140. share/doc/qt5/qtmultimedia/qvideofilterrunnable.html
  7141. share/doc/qt5/qtmultimedia/qvideoframe-members.html
  7142. share/doc/qt5/qtmultimedia/qvideoframe.html
  7143. share/doc/qt5/qtmultimedia/qvideoprobe-members.html
  7144. share/doc/qt5/qtmultimedia/qvideoprobe-obsolete.html
  7145. share/doc/qt5/qtmultimedia/qvideoprobe.html
  7146. share/doc/qt5/qtmultimedia/qvideorenderercontrol-members.html
  7147. share/doc/qt5/qtmultimedia/qvideorenderercontrol-obsolete.html
  7148. share/doc/qt5/qtmultimedia/qvideorenderercontrol.html
  7149. share/doc/qt5/qtmultimedia/qvideosurfaceformat-members.html
  7150. share/doc/qt5/qtmultimedia/qvideosurfaceformat.html
  7151. share/doc/qt5/qtmultimedia/qvideowidget-members.html
  7152. share/doc/qt5/qtmultimedia/qvideowidget-obsolete.html
  7153. share/doc/qt5/qtmultimedia/qvideowidget.html
  7154. share/doc/qt5/qtmultimedia/qvideowidgetcontrol-members.html
  7155. share/doc/qt5/qtmultimedia/qvideowidgetcontrol-obsolete.html
  7156. share/doc/qt5/qtmultimedia/qvideowidgetcontrol.html
  7157. share/doc/qt5/qtmultimedia/qvideowindowcontrol-members.html
  7158. share/doc/qt5/qtmultimedia/qvideowindowcontrol-obsolete.html
  7159. share/doc/qt5/qtmultimedia/qvideowindowcontrol.html
  7160. share/doc/qt5/qtmultimedia/radiooverview.html
  7161. share/doc/qt5/qtmultimedia/style/offline-simple.css
  7162. share/doc/qt5/qtmultimedia/style/offline.css
  7163. share/doc/qt5/qtmultimedia/videooverview.html
  7164. share/doc/qt5/qtnetwork.qch
  7165. share/doc/qt5/qtnetwork/bearer-management.html
  7166. share/doc/qt5/qtnetwork/examples-manifest.xml
  7167. share/doc/qt5/qtnetwork/examples-network.html
  7168. share/doc/qt5/qtnetwork/images/arrow_bc.png
  7169. share/doc/qt5/qtnetwork/images/bgrContent.png
  7170. share/doc/qt5/qtnetwork/images/blockingfortuneclient-example.png
  7171. share/doc/qt5/qtnetwork/images/broadcastreceiver-example.png
  7172. share/doc/qt5/qtnetwork/images/broadcastsender-example.png
  7173. share/doc/qt5/qtnetwork/images/btn_next.png
  7174. share/doc/qt5/qtnetwork/images/btn_prev.png
  7175. share/doc/qt5/qtnetwork/images/bullet_dn.png
  7176. share/doc/qt5/qtnetwork/images/bullet_sq.png
  7177. share/doc/qt5/qtnetwork/images/fortuneclient-example.png
  7178. share/doc/qt5/qtnetwork/images/fortuneserver-example.png
  7179. share/doc/qt5/qtnetwork/images/googlesuggest-example.png
  7180. share/doc/qt5/qtnetwork/images/home.png
  7181. share/doc/qt5/qtnetwork/images/http-example.png
  7182. share/doc/qt5/qtnetwork/images/ico_note.png
  7183. share/doc/qt5/qtnetwork/images/ico_note_attention.png
  7184. share/doc/qt5/qtnetwork/images/ico_out.png
  7185. share/doc/qt5/qtnetwork/images/logo.png
  7186. share/doc/qt5/qtnetwork/images/loopback-example.png
  7187. share/doc/qt5/qtnetwork/images/multicastreceiver-example.png
  7188. share/doc/qt5/qtnetwork/images/multicastsender-example.png
  7189. share/doc/qt5/qtnetwork/images/network-chat-example.png
  7190. share/doc/qt5/qtnetwork/images/network-examples.png
  7191. share/doc/qt5/qtnetwork/images/roaming-states.png
  7192. share/doc/qt5/qtnetwork/images/securesocketclient.png
  7193. share/doc/qt5/qtnetwork/images/securesocketclient2.png
  7194. share/doc/qt5/qtnetwork/images/secureudpclient-example.png
  7195. share/doc/qt5/qtnetwork/images/secureudpserver-example.png
  7196. share/doc/qt5/qtnetwork/images/tcpstream.png
  7197. share/doc/qt5/qtnetwork/images/threadedfortuneserver-example.png
  7198. share/doc/qt5/qtnetwork/images/torrent-example.png
  7199. share/doc/qt5/qtnetwork/images/udppackets.png
  7200. share/doc/qt5/qtnetwork/images/used-in-examples/securesocketclient/encrypted.png
  7201. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/1downarrow.png
  7202. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/1uparrow.png
  7203. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/bottom.png
  7204. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/edit_add.png
  7205. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/edit_remove.png
  7206. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/exit.png
  7207. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/peertopeer.png
  7208. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_pause.png
  7209. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_play.png
  7210. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/player_stop.png
  7211. share/doc/qt5/qtnetwork/images/used-in-examples/torrent/icons/stop.png
  7212. share/doc/qt5/qtnetwork/network.html
  7213. share/doc/qt5/qtnetwork/qabstractnetworkcache-members.html
  7214. share/doc/qt5/qtnetwork/qabstractnetworkcache-obsolete.html
  7215. share/doc/qt5/qtnetwork/qabstractnetworkcache.html
  7216. share/doc/qt5/qtnetwork/qabstractsocket-members.html
  7217. share/doc/qt5/qtnetwork/qabstractsocket-obsolete.html
  7218. share/doc/qt5/qtnetwork/qabstractsocket.html
  7219. share/doc/qt5/qtnetwork/qauthenticator-members.html
  7220. share/doc/qt5/qtnetwork/qauthenticator.html
  7221. share/doc/qt5/qtnetwork/qdnsdomainnamerecord-members.html
  7222. share/doc/qt5/qtnetwork/qdnsdomainnamerecord.html
  7223. share/doc/qt5/qtnetwork/qdnshostaddressrecord-members.html
  7224. share/doc/qt5/qtnetwork/qdnshostaddressrecord.html
  7225. share/doc/qt5/qtnetwork/qdnslookup-members.html
  7226. share/doc/qt5/qtnetwork/qdnslookup-obsolete.html
  7227. share/doc/qt5/qtnetwork/qdnslookup.html
  7228. share/doc/qt5/qtnetwork/qdnsmailexchangerecord-members.html
  7229. share/doc/qt5/qtnetwork/qdnsmailexchangerecord.html
  7230. share/doc/qt5/qtnetwork/qdnsservicerecord-members.html
  7231. share/doc/qt5/qtnetwork/qdnsservicerecord.html
  7232. share/doc/qt5/qtnetwork/qdnstextrecord-members.html
  7233. share/doc/qt5/qtnetwork/qdnstextrecord.html
  7234. share/doc/qt5/qtnetwork/qdtls-members.html
  7235. share/doc/qt5/qtnetwork/qdtls-obsolete.html
  7236. share/doc/qt5/qtnetwork/qdtls.html
  7237. share/doc/qt5/qtnetwork/qdtlsclientverifier-generatorparameters-members.html
  7238. share/doc/qt5/qtnetwork/qdtlsclientverifier-generatorparameters.html
  7239. share/doc/qt5/qtnetwork/qdtlsclientverifier-members.html
  7240. share/doc/qt5/qtnetwork/qdtlsclientverifier-obsolete.html
  7241. share/doc/qt5/qtnetwork/qdtlsclientverifier.html
  7242. share/doc/qt5/qtnetwork/qhostaddress-members.html
  7243. share/doc/qt5/qtnetwork/qhostaddress.html
  7244. share/doc/qt5/qtnetwork/qhostinfo-members.html
  7245. share/doc/qt5/qtnetwork/qhostinfo.html
  7246. share/doc/qt5/qtnetwork/qhstspolicy-members.html
  7247. share/doc/qt5/qtnetwork/qhstspolicy.html
  7248. share/doc/qt5/qtnetwork/qhttpmultipart-members.html
  7249. share/doc/qt5/qtnetwork/qhttpmultipart-obsolete.html
  7250. share/doc/qt5/qtnetwork/qhttpmultipart.html
  7251. share/doc/qt5/qtnetwork/qhttppart-members.html
  7252. share/doc/qt5/qtnetwork/qhttppart.html
  7253. share/doc/qt5/qtnetwork/qlocalserver-members.html
  7254. share/doc/qt5/qtnetwork/qlocalserver-obsolete.html
  7255. share/doc/qt5/qtnetwork/qlocalserver.html
  7256. share/doc/qt5/qtnetwork/qlocalsocket-members.html
  7257. share/doc/qt5/qtnetwork/qlocalsocket-obsolete.html
  7258. share/doc/qt5/qtnetwork/qlocalsocket.html
  7259. share/doc/qt5/qtnetwork/qnetworkaccessmanager-members.html
  7260. share/doc/qt5/qtnetwork/qnetworkaccessmanager-obsolete.html
  7261. share/doc/qt5/qtnetwork/qnetworkaccessmanager.html
  7262. share/doc/qt5/qtnetwork/qnetworkaddressentry-members.html
  7263. share/doc/qt5/qtnetwork/qnetworkaddressentry.html
  7264. share/doc/qt5/qtnetwork/qnetworkcachemetadata-members.html
  7265. share/doc/qt5/qtnetwork/qnetworkcachemetadata.html
  7266. share/doc/qt5/qtnetwork/qnetworkconfiguration-members.html
  7267. share/doc/qt5/qtnetwork/qnetworkconfiguration.html
  7268. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager-members.html
  7269. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager-obsolete.html
  7270. share/doc/qt5/qtnetwork/qnetworkconfigurationmanager.html
  7271. share/doc/qt5/qtnetwork/qnetworkcookie-members.html
  7272. share/doc/qt5/qtnetwork/qnetworkcookie.html
  7273. share/doc/qt5/qtnetwork/qnetworkcookiejar-members.html
  7274. share/doc/qt5/qtnetwork/qnetworkcookiejar-obsolete.html
  7275. share/doc/qt5/qtnetwork/qnetworkcookiejar.html
  7276. share/doc/qt5/qtnetwork/qnetworkdatagram-members.html
  7277. share/doc/qt5/qtnetwork/qnetworkdatagram.html
  7278. share/doc/qt5/qtnetwork/qnetworkdiskcache-members.html
  7279. share/doc/qt5/qtnetwork/qnetworkdiskcache-obsolete.html
  7280. share/doc/qt5/qtnetwork/qnetworkdiskcache.html
  7281. share/doc/qt5/qtnetwork/qnetworkinterface-members.html
  7282. share/doc/qt5/qtnetwork/qnetworkinterface.html
  7283. share/doc/qt5/qtnetwork/qnetworkproxy-members.html
  7284. share/doc/qt5/qtnetwork/qnetworkproxy.html
  7285. share/doc/qt5/qtnetwork/qnetworkproxyfactory-members.html
  7286. share/doc/qt5/qtnetwork/qnetworkproxyfactory.html
  7287. share/doc/qt5/qtnetwork/qnetworkproxyquery-members.html
  7288. share/doc/qt5/qtnetwork/qnetworkproxyquery-obsolete.html
  7289. share/doc/qt5/qtnetwork/qnetworkproxyquery.html
  7290. share/doc/qt5/qtnetwork/qnetworkreply-members.html
  7291. share/doc/qt5/qtnetwork/qnetworkreply-obsolete.html
  7292. share/doc/qt5/qtnetwork/qnetworkreply.html
  7293. share/doc/qt5/qtnetwork/qnetworkrequest-members.html
  7294. share/doc/qt5/qtnetwork/qnetworkrequest.html
  7295. share/doc/qt5/qtnetwork/qnetworksession-members.html
  7296. share/doc/qt5/qtnetwork/qnetworksession-obsolete.html
  7297. share/doc/qt5/qtnetwork/qnetworksession.html
  7298. share/doc/qt5/qtnetwork/qpassworddigestor.html
  7299. share/doc/qt5/qtnetwork/qsctpserver-members.html
  7300. share/doc/qt5/qtnetwork/qsctpserver-obsolete.html
  7301. share/doc/qt5/qtnetwork/qsctpserver.html
  7302. share/doc/qt5/qtnetwork/qsctpsocket-members.html
  7303. share/doc/qt5/qtnetwork/qsctpsocket-obsolete.html
  7304. share/doc/qt5/qtnetwork/qsctpsocket.html
  7305. share/doc/qt5/qtnetwork/qssl-obsolete.html
  7306. share/doc/qt5/qtnetwork/qssl.html
  7307. share/doc/qt5/qtnetwork/qsslcertificate-members.html
  7308. share/doc/qt5/qtnetwork/qsslcertificate-obsolete.html
  7309. share/doc/qt5/qtnetwork/qsslcertificate.html
  7310. share/doc/qt5/qtnetwork/qsslcertificateextension-members.html
  7311. share/doc/qt5/qtnetwork/qsslcertificateextension.html
  7312. share/doc/qt5/qtnetwork/qsslcipher-members.html
  7313. share/doc/qt5/qtnetwork/qsslcipher.html
  7314. share/doc/qt5/qtnetwork/qsslconfiguration-members.html
  7315. share/doc/qt5/qtnetwork/qsslconfiguration.html
  7316. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters-members.html
  7317. share/doc/qt5/qtnetwork/qssldiffiehellmanparameters.html
  7318. share/doc/qt5/qtnetwork/qsslellipticcurve-members.html
  7319. share/doc/qt5/qtnetwork/qsslellipticcurve.html
  7320. share/doc/qt5/qtnetwork/qsslerror-members.html
  7321. share/doc/qt5/qtnetwork/qsslerror.html
  7322. share/doc/qt5/qtnetwork/qsslkey-members.html
  7323. share/doc/qt5/qtnetwork/qsslkey.html
  7324. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator-members.html
  7325. share/doc/qt5/qtnetwork/qsslpresharedkeyauthenticator.html
  7326. share/doc/qt5/qtnetwork/qsslsocket-members.html
  7327. share/doc/qt5/qtnetwork/qsslsocket-obsolete.html
  7328. share/doc/qt5/qtnetwork/qsslsocket.html
  7329. share/doc/qt5/qtnetwork/qtcpserver-members.html
  7330. share/doc/qt5/qtnetwork/qtcpserver-obsolete.html
  7331. share/doc/qt5/qtnetwork/qtcpserver.html
  7332. share/doc/qt5/qtnetwork/qtcpsocket-members.html
  7333. share/doc/qt5/qtnetwork/qtcpsocket-obsolete.html
  7334. share/doc/qt5/qtnetwork/qtcpsocket.html
  7335. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-cpp.html
  7336. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingclient-h.html
  7337. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-blockingfortuneclient-pro.html
  7338. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-example.html
  7339. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-cpp.html
  7340. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-fortunethread-h.html
  7341. share/doc/qt5/qtnetwork/qtnetwork-blockingfortuneclient-main-cpp.html
  7342. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-broadcastreceiver-pro.html
  7343. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-example.html
  7344. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-main-cpp.html
  7345. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-cpp.html
  7346. share/doc/qt5/qtnetwork/qtnetwork-broadcastreceiver-receiver-h.html
  7347. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-broadcastsender-pro.html
  7348. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-example.html
  7349. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-main-cpp.html
  7350. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-cpp.html
  7351. share/doc/qt5/qtnetwork/qtnetwork-broadcastsender-sender-h.html
  7352. share/doc/qt5/qtnetwork/qtnetwork-download-download-pro.html
  7353. share/doc/qt5/qtnetwork/qtnetwork-download-example.html
  7354. share/doc/qt5/qtnetwork/qtnetwork-download-main-cpp.html
  7355. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-cpp.html
  7356. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-h.html
  7357. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-downloadmanager-pro.html
  7358. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-example.html
  7359. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-main-cpp.html
  7360. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-cpp.html
  7361. share/doc/qt5/qtnetwork/qtnetwork-downloadmanager-textprogressbar-h.html
  7362. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-cpp.html
  7363. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-client-h.html
  7364. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-example.html
  7365. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-fortuneclient-pro.html
  7366. share/doc/qt5/qtnetwork/qtnetwork-fortuneclient-main-cpp.html
  7367. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-example.html
  7368. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-fortuneserver-pro.html
  7369. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-main-cpp.html
  7370. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-cpp.html
  7371. share/doc/qt5/qtnetwork/qtnetwork-fortuneserver-server-h.html
  7372. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-example.html
  7373. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-cpp.html
  7374. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-h.html
  7375. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-googlesuggest-pro.html
  7376. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-main-cpp.html
  7377. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-cpp.html
  7378. share/doc/qt5/qtnetwork/qtnetwork-googlesuggest-searchbox-h.html
  7379. share/doc/qt5/qtnetwork/qtnetwork-http-authenticationdialog-ui.html
  7380. share/doc/qt5/qtnetwork/qtnetwork-http-example.html
  7381. share/doc/qt5/qtnetwork/qtnetwork-http-http-pro.html
  7382. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-cpp.html
  7383. share/doc/qt5/qtnetwork/qtnetwork-http-httpwindow-h.html
  7384. share/doc/qt5/qtnetwork/qtnetwork-http-main-cpp.html
  7385. share/doc/qt5/qtnetwork/qtnetwork-index.html
  7386. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-cpp.html
  7387. share/doc/qt5/qtnetwork/qtnetwork-loopback-dialog-h.html
  7388. share/doc/qt5/qtnetwork/qtnetwork-loopback-example.html
  7389. share/doc/qt5/qtnetwork/qtnetwork-loopback-loopback-pro.html
  7390. share/doc/qt5/qtnetwork/qtnetwork-loopback-main-cpp.html
  7391. share/doc/qt5/qtnetwork/qtnetwork-module.html
  7392. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-example.html
  7393. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-main-cpp.html
  7394. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-multicastreceiver-pro.html
  7395. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-cpp.html
  7396. share/doc/qt5/qtnetwork/qtnetwork-multicastreceiver-receiver-h.html
  7397. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-example.html
  7398. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-main-cpp.html
  7399. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-multicastsender-pro.html
  7400. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-cpp.html
  7401. share/doc/qt5/qtnetwork/qtnetwork-multicastsender-sender-h.html
  7402. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-cpp.html
  7403. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-h.html
  7404. share/doc/qt5/qtnetwork/qtnetwork-network-chat-chatdialog-ui.html
  7405. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-cpp.html
  7406. share/doc/qt5/qtnetwork/qtnetwork-network-chat-client-h.html
  7407. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-cpp.html
  7408. share/doc/qt5/qtnetwork/qtnetwork-network-chat-connection-h.html
  7409. share/doc/qt5/qtnetwork/qtnetwork-network-chat-example.html
  7410. share/doc/qt5/qtnetwork/qtnetwork-network-chat-main-cpp.html
  7411. share/doc/qt5/qtnetwork/qtnetwork-network-chat-network-chat-pro.html
  7412. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-cpp.html
  7413. share/doc/qt5/qtnetwork/qtnetwork-network-chat-peermanager-h.html
  7414. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-cpp.html
  7415. share/doc/qt5/qtnetwork/qtnetwork-network-chat-server-h.html
  7416. share/doc/qt5/qtnetwork/qtnetwork-programming.html
  7417. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-cpp.html
  7418. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-h.html
  7419. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-certificateinfo-ui.html
  7420. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-example.html
  7421. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-main-cpp.html
  7422. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-pro.html
  7423. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-securesocketclient-qrc.html
  7424. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-cpp.html
  7425. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-h.html
  7426. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslclient-ui.html
  7427. share/doc/qt5/qtnetwork/qtnetwork-securesocketclient-sslerrors-ui.html
  7428. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-addressdialog-cpp.html
  7429. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-addressdialog-h.html
  7430. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-addressdialog-ui.html
  7431. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-association-cpp.html
  7432. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-association-h.html
  7433. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-example.html
  7434. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-main-cpp.html
  7435. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-mainwindow-cpp.html
  7436. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-mainwindow-h.html
  7437. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-mainwindow-ui.html
  7438. share/doc/qt5/qtnetwork/qtnetwork-secureudpclient-secureudpclient-pro.html
  7439. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-example.html
  7440. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-main-cpp.html
  7441. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-mainwindow-cpp.html
  7442. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-mainwindow-h.html
  7443. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-mainwindow-ui.html
  7444. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-nicselector-cpp.html
  7445. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-nicselector-h.html
  7446. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-nicselector-ui.html
  7447. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-secureudpserver-pro.html
  7448. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-server-cpp.html
  7449. share/doc/qt5/qtnetwork/qtnetwork-secureudpserver-server-h.html
  7450. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-cpp.html
  7451. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-dialog-h.html
  7452. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-example.html
  7453. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-cpp.html
  7454. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortuneserver-h.html
  7455. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-cpp.html
  7456. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-fortunethread-h.html
  7457. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-main-cpp.html
  7458. share/doc/qt5/qtnetwork/qtnetwork-threadedfortuneserver-threadedfortuneserver-pro.html
  7459. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-cpp.html
  7460. share/doc/qt5/qtnetwork/qtnetwork-torrent-addtorrentdialog-h.html
  7461. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-cpp.html
  7462. share/doc/qt5/qtnetwork/qtnetwork-torrent-bencodeparser-h.html
  7463. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-cpp.html
  7464. share/doc/qt5/qtnetwork/qtnetwork-torrent-connectionmanager-h.html
  7465. share/doc/qt5/qtnetwork/qtnetwork-torrent-example.html
  7466. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-cpp.html
  7467. share/doc/qt5/qtnetwork/qtnetwork-torrent-filemanager-h.html
  7468. share/doc/qt5/qtnetwork/qtnetwork-torrent-forms-addtorrentform-ui.html
  7469. share/doc/qt5/qtnetwork/qtnetwork-torrent-icons-qrc.html
  7470. share/doc/qt5/qtnetwork/qtnetwork-torrent-main-cpp.html
  7471. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-cpp.html
  7472. share/doc/qt5/qtnetwork/qtnetwork-torrent-mainwindow-h.html
  7473. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-cpp.html
  7474. share/doc/qt5/qtnetwork/qtnetwork-torrent-metainfo-h.html
  7475. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-cpp.html
  7476. share/doc/qt5/qtnetwork/qtnetwork-torrent-peerwireclient-h.html
  7477. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-cpp.html
  7478. share/doc/qt5/qtnetwork/qtnetwork-torrent-ratecontroller-h.html
  7479. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrent-pro.html
  7480. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-cpp.html
  7481. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentclient-h.html
  7482. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-cpp.html
  7483. share/doc/qt5/qtnetwork/qtnetwork-torrent-torrentserver-h.html
  7484. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-cpp.html
  7485. share/doc/qt5/qtnetwork/qtnetwork-torrent-trackerclient-h.html
  7486. share/doc/qt5/qtnetwork/qtnetwork.index
  7487. share/doc/qt5/qtnetwork/qtnetwork.qhp
  7488. share/doc/qt5/qtnetwork/qtnetwork.qhp.sha1
  7489. share/doc/qt5/qtnetwork/qtnetwork.tags
  7490. share/doc/qt5/qtnetwork/qudpsocket-members.html
  7491. share/doc/qt5/qtnetwork/qudpsocket-obsolete.html
  7492. share/doc/qt5/qtnetwork/qudpsocket.html
  7493. share/doc/qt5/qtnetwork/ssl.html
  7494. share/doc/qt5/qtnetwork/style/offline-simple.css
  7495. share/doc/qt5/qtnetwork/style/offline.css
  7496. share/doc/qt5/qtnfc.qch
  7497. share/doc/qt5/qtnfc/examples-manifest.xml
  7498. share/doc/qt5/qtnfc/images/annotatedurl.png
  7499. share/doc/qt5/qtnfc/images/annotatedurl2.png
  7500. share/doc/qt5/qtnfc/images/arrow_bc.png
  7501. share/doc/qt5/qtnfc/images/bgrContent.png
  7502. share/doc/qt5/qtnfc/images/btn_next.png
  7503. share/doc/qt5/qtnfc/images/btn_prev.png
  7504. share/doc/qt5/qtnfc/images/bullet_dn.png
  7505. share/doc/qt5/qtnfc/images/bullet_sq.png
  7506. share/doc/qt5/qtnfc/images/corkboard.png
  7507. share/doc/qt5/qtnfc/images/home.png
  7508. share/doc/qt5/qtnfc/images/ico_note.png
  7509. share/doc/qt5/qtnfc/images/ico_note_attention.png
  7510. share/doc/qt5/qtnfc/images/ico_out.png
  7511. share/doc/qt5/qtnfc/images/logo.png
  7512. share/doc/qt5/qtnfc/images/ndefeditor.png
  7513. share/doc/qt5/qtnfc/images/qml-poster-example.png
  7514. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/NfcFlag.png
  7515. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/cork.jpg
  7516. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/icon.png
  7517. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/note-yellow.png
  7518. share/doc/qt5/qtnfc/images/used-in-examples/corkboard/tack.png
  7519. share/doc/qt5/qtnfc/nfc-android.html
  7520. share/doc/qt5/qtnfc/nfc-examples.html
  7521. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter-members.html
  7522. share/doc/qt5/qtnfc/qml-qtnfc-ndeffilter.html
  7523. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord-members.html
  7524. share/doc/qt5/qtnfc/qml-qtnfc-ndefmimerecord.html
  7525. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord-members.html
  7526. share/doc/qt5/qtnfc/qml-qtnfc-ndefrecord.html
  7527. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord-members.html
  7528. share/doc/qt5/qtnfc/qml-qtnfc-ndeftextrecord.html
  7529. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord-members.html
  7530. share/doc/qt5/qtnfc/qml-qtnfc-ndefurirecord.html
  7531. share/doc/qt5/qtnfc/qml-qtnfc-nearfield-members.html
  7532. share/doc/qt5/qtnfc/qml-qtnfc-nearfield.html
  7533. share/doc/qt5/qtnfc/qndeffilter-members.html
  7534. share/doc/qt5/qtnfc/qndeffilter-record-members.html
  7535. share/doc/qt5/qtnfc/qndeffilter-record.html
  7536. share/doc/qt5/qtnfc/qndeffilter.html
  7537. share/doc/qt5/qtnfc/qndefmessage-members.html
  7538. share/doc/qt5/qtnfc/qndefmessage.html
  7539. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord-members.html
  7540. share/doc/qt5/qtnfc/qndefnfcsmartposterrecord.html
  7541. share/doc/qt5/qtnfc/qndefnfctextrecord-members.html
  7542. share/doc/qt5/qtnfc/qndefnfctextrecord.html
  7543. share/doc/qt5/qtnfc/qndefnfcurirecord-members.html
  7544. share/doc/qt5/qtnfc/qndefnfcurirecord.html
  7545. share/doc/qt5/qtnfc/qndefrecord-members.html
  7546. share/doc/qt5/qtnfc/qndefrecord.html
  7547. share/doc/qt5/qtnfc/qnearfieldmanager-members.html
  7548. share/doc/qt5/qtnfc/qnearfieldmanager-obsolete.html
  7549. share/doc/qt5/qtnfc/qnearfieldmanager.html
  7550. share/doc/qt5/qtnfc/qnearfieldsharemanager-members.html
  7551. share/doc/qt5/qtnfc/qnearfieldsharemanager-obsolete.html
  7552. share/doc/qt5/qtnfc/qnearfieldsharemanager.html
  7553. share/doc/qt5/qtnfc/qnearfieldsharetarget-members.html
  7554. share/doc/qt5/qtnfc/qnearfieldsharetarget-obsolete.html
  7555. share/doc/qt5/qtnfc/qnearfieldsharetarget.html
  7556. share/doc/qt5/qtnfc/qnearfieldtarget-members.html
  7557. share/doc/qt5/qtnfc/qnearfieldtarget-obsolete.html
  7558. share/doc/qt5/qtnfc/qnearfieldtarget-requestid-members.html
  7559. share/doc/qt5/qtnfc/qnearfieldtarget-requestid.html
  7560. share/doc/qt5/qtnfc/qnearfieldtarget-requestidprivate-members.html
  7561. share/doc/qt5/qtnfc/qnearfieldtarget-requestidprivate.html
  7562. share/doc/qt5/qtnfc/qnearfieldtarget.html
  7563. share/doc/qt5/qtnfc/qqmlndefrecord-members.html
  7564. share/doc/qt5/qtnfc/qqmlndefrecord-obsolete.html
  7565. share/doc/qt5/qtnfc/qqmlndefrecord.html
  7566. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-cpp.html
  7567. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-h.html
  7568. share/doc/qt5/qtnfc/qtnfc-annotatedurl-annotatedurl-pro.html
  7569. share/doc/qt5/qtnfc/qtnfc-annotatedurl-example.html
  7570. share/doc/qt5/qtnfc/qtnfc-annotatedurl-main-cpp.html
  7571. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-cpp.html
  7572. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-h.html
  7573. share/doc/qt5/qtnfc/qtnfc-annotatedurl-mainwindow-ui.html
  7574. share/doc/qt5/qtnfc/qtnfc-corkboard-android-androidmanifest-xml.html
  7575. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-pro.html
  7576. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboard-qrc.html
  7577. share/doc/qt5/qtnfc/qtnfc-corkboard-corkboards-qml.html
  7578. share/doc/qt5/qtnfc/qtnfc-corkboard-example.html
  7579. share/doc/qt5/qtnfc/qtnfc-corkboard-main-cpp.html
  7580. share/doc/qt5/qtnfc/qtnfc-corkboard-mode-qml.html
  7581. share/doc/qt5/qtnfc/qtnfc-index.html
  7582. share/doc/qt5/qtnfc/qtnfc-module.html
  7583. share/doc/qt5/qtnfc/qtnfc-ndefeditor-example.html
  7584. share/doc/qt5/qtnfc/qtnfc-ndefeditor-main-cpp.html
  7585. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-cpp.html
  7586. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-h.html
  7587. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mainwindow-ui.html
  7588. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-cpp.html
  7589. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-h.html
  7590. share/doc/qt5/qtnfc/qtnfc-ndefeditor-mimeimagerecordeditor-ui.html
  7591. share/doc/qt5/qtnfc/qtnfc-ndefeditor-ndefeditor-pro.html
  7592. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-cpp.html
  7593. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-h.html
  7594. share/doc/qt5/qtnfc/qtnfc-ndefeditor-textrecordeditor-ui.html
  7595. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-cpp.html
  7596. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-h.html
  7597. share/doc/qt5/qtnfc/qtnfc-ndefeditor-urirecordeditor-ui.html
  7598. share/doc/qt5/qtnfc/qtnfc-overview.html
  7599. share/doc/qt5/qtnfc/qtnfc-poster-example.html
  7600. share/doc/qt5/qtnfc/qtnfc-poster-poster-pro.html
  7601. share/doc/qt5/qtnfc/qtnfc-poster-poster-qml.html
  7602. share/doc/qt5/qtnfc/qtnfc-poster-poster-qrc.html
  7603. share/doc/qt5/qtnfc/qtnfc-poster-qmlposter-cpp.html
  7604. share/doc/qt5/qtnfc/qtnfc-qmlmodule.html
  7605. share/doc/qt5/qtnfc/qtnfc.index
  7606. share/doc/qt5/qtnfc/qtnfc.qhp
  7607. share/doc/qt5/qtnfc/qtnfc.qhp.sha1
  7608. share/doc/qt5/qtnfc/qtnfc.tags
  7609. share/doc/qt5/qtnfc/style/offline-simple.css
  7610. share/doc/qt5/qtnfc/style/offline.css
  7611. share/doc/qt5/qtopengl.qch
  7612. share/doc/qt5/qtopengl/examples-manifest.xml
  7613. share/doc/qt5/qtopengl/examples-widgets-opengl.html
  7614. share/doc/qt5/qtopengl/images/2dpainting-example.png
  7615. share/doc/qt5/qtopengl/images/arrow_bc.png
  7616. share/doc/qt5/qtopengl/images/bgrContent.png
  7617. share/doc/qt5/qtopengl/images/btn_next.png
  7618. share/doc/qt5/qtopengl/images/btn_prev.png
  7619. share/doc/qt5/qtopengl/images/bullet_dn.png
  7620. share/doc/qt5/qtopengl/images/bullet_sq.png
  7621. share/doc/qt5/qtopengl/images/cube.png
  7622. share/doc/qt5/qtopengl/images/cube_faces.png
  7623. share/doc/qt5/qtopengl/images/hellogl2-example.png
  7624. share/doc/qt5/qtopengl/images/hellogles3-example.png
  7625. share/doc/qt5/qtopengl/images/home.png
  7626. share/doc/qt5/qtopengl/images/ico_note.png
  7627. share/doc/qt5/qtopengl/images/ico_note_attention.png
  7628. share/doc/qt5/qtopengl/images/ico_out.png
  7629. share/doc/qt5/qtopengl/images/logo.png
  7630. share/doc/qt5/qtopengl/images/opengl-examples.png
  7631. share/doc/qt5/qtopengl/images/textures-example.png
  7632. share/doc/qt5/qtopengl/images/used-in-examples/cube/cube.png
  7633. share/doc/qt5/qtopengl/images/used-in-examples/hellogles3/qtlogo.png
  7634. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side1.png
  7635. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side2.png
  7636. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side3.png
  7637. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side4.png
  7638. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side5.png
  7639. share/doc/qt5/qtopengl/images/used-in-examples/textures/images/side6.png
  7640. share/doc/qt5/qtopengl/qgl.html
  7641. share/doc/qt5/qtopengl/qglbuffer-members.html
  7642. share/doc/qt5/qtopengl/qglbuffer.html
  7643. share/doc/qt5/qtopengl/qglcolormap-members.html
  7644. share/doc/qt5/qtopengl/qglcolormap.html
  7645. share/doc/qt5/qtopengl/qglcontext-members.html
  7646. share/doc/qt5/qtopengl/qglcontext-obsolete.html
  7647. share/doc/qt5/qtopengl/qglcontext.html
  7648. share/doc/qt5/qtopengl/qglformat-members.html
  7649. share/doc/qt5/qtopengl/qglformat.html
  7650. share/doc/qt5/qtopengl/qglframebufferobject-members.html
  7651. share/doc/qt5/qtopengl/qglframebufferobject.html
  7652. share/doc/qt5/qtopengl/qglframebufferobjectformat-members.html
  7653. share/doc/qt5/qtopengl/qglframebufferobjectformat.html
  7654. share/doc/qt5/qtopengl/qglfunctions-members.html
  7655. share/doc/qt5/qtopengl/qglfunctions.html
  7656. share/doc/qt5/qtopengl/qglpixelbuffer-members.html
  7657. share/doc/qt5/qtopengl/qglpixelbuffer.html
  7658. share/doc/qt5/qtopengl/qglshader-members.html
  7659. share/doc/qt5/qtopengl/qglshader-obsolete.html
  7660. share/doc/qt5/qtopengl/qglshader.html
  7661. share/doc/qt5/qtopengl/qglshaderprogram-members.html
  7662. share/doc/qt5/qtopengl/qglshaderprogram-obsolete.html
  7663. share/doc/qt5/qtopengl/qglshaderprogram.html
  7664. share/doc/qt5/qtopengl/qglwidget-members.html
  7665. share/doc/qt5/qtopengl/qglwidget-obsolete.html
  7666. share/doc/qt5/qtopengl/qglwidget.html
  7667. share/doc/qt5/qtopengl/qtopengl-2dpainting-2dpainting-pro.html
  7668. share/doc/qt5/qtopengl/qtopengl-2dpainting-example.html
  7669. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-cpp.html
  7670. share/doc/qt5/qtopengl/qtopengl-2dpainting-glwidget-h.html
  7671. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-cpp.html
  7672. share/doc/qt5/qtopengl/qtopengl-2dpainting-helper-h.html
  7673. share/doc/qt5/qtopengl/qtopengl-2dpainting-main-cpp.html
  7674. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-cpp.html
  7675. share/doc/qt5/qtopengl/qtopengl-2dpainting-widget-h.html
  7676. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-cpp.html
  7677. share/doc/qt5/qtopengl/qtopengl-2dpainting-window-h.html
  7678. share/doc/qt5/qtopengl/qtopengl-cube-cube-pro.html
  7679. share/doc/qt5/qtopengl/qtopengl-cube-example.html
  7680. share/doc/qt5/qtopengl/qtopengl-cube-fshader-glsl.html
  7681. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-cpp.html
  7682. share/doc/qt5/qtopengl/qtopengl-cube-geometryengine-h.html
  7683. share/doc/qt5/qtopengl/qtopengl-cube-main-cpp.html
  7684. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-cpp.html
  7685. share/doc/qt5/qtopengl/qtopengl-cube-mainwidget-h.html
  7686. share/doc/qt5/qtopengl/qtopengl-cube-shaders-qrc.html
  7687. share/doc/qt5/qtopengl/qtopengl-cube-textures-qrc.html
  7688. share/doc/qt5/qtopengl/qtopengl-cube-vshader-glsl.html
  7689. share/doc/qt5/qtopengl/qtopengl-hellogl2-example.html
  7690. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-cpp.html
  7691. share/doc/qt5/qtopengl/qtopengl-hellogl2-glwidget-h.html
  7692. share/doc/qt5/qtopengl/qtopengl-hellogl2-hellogl2-pro.html
  7693. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-cpp.html
  7694. share/doc/qt5/qtopengl/qtopengl-hellogl2-logo-h.html
  7695. share/doc/qt5/qtopengl/qtopengl-hellogl2-main-cpp.html
  7696. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-cpp.html
  7697. share/doc/qt5/qtopengl/qtopengl-hellogl2-mainwindow-h.html
  7698. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-cpp.html
  7699. share/doc/qt5/qtopengl/qtopengl-hellogl2-window-h.html
  7700. share/doc/qt5/qtopengl/qtopengl-hellogles3-example.html
  7701. share/doc/qt5/qtopengl/qtopengl-hellogles3-glwindow-cpp.html
  7702. share/doc/qt5/qtopengl/qtopengl-hellogles3-glwindow-h.html
  7703. share/doc/qt5/qtopengl/qtopengl-hellogles3-hellogles3-pro.html
  7704. share/doc/qt5/qtopengl/qtopengl-hellogles3-hellogles3-qrc.html
  7705. share/doc/qt5/qtopengl/qtopengl-hellogles3-main-cpp.html
  7706. share/doc/qt5/qtopengl/qtopengl-index.html
  7707. share/doc/qt5/qtopengl/qtopengl-module.html
  7708. share/doc/qt5/qtopengl/qtopengl-textures-example.html
  7709. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-cpp.html
  7710. share/doc/qt5/qtopengl/qtopengl-textures-glwidget-h.html
  7711. share/doc/qt5/qtopengl/qtopengl-textures-main-cpp.html
  7712. share/doc/qt5/qtopengl/qtopengl-textures-textures-pro.html
  7713. share/doc/qt5/qtopengl/qtopengl-textures-textures-qrc.html
  7714. share/doc/qt5/qtopengl/qtopengl-textures-window-cpp.html
  7715. share/doc/qt5/qtopengl/qtopengl-textures-window-h.html
  7716. share/doc/qt5/qtopengl/qtopengl.index
  7717. share/doc/qt5/qtopengl/qtopengl.qhp
  7718. share/doc/qt5/qtopengl/qtopengl.qhp.sha1
  7719. share/doc/qt5/qtopengl/style/offline-simple.css
  7720. share/doc/qt5/qtopengl/style/offline.css
  7721. share/doc/qt5/qtplatformheaders.qch
  7722. share/doc/qt5/qtplatformheaders/images/arrow_bc.png
  7723. share/doc/qt5/qtplatformheaders/images/bgrContent.png
  7724. share/doc/qt5/qtplatformheaders/images/btn_next.png
  7725. share/doc/qt5/qtplatformheaders/images/btn_prev.png
  7726. share/doc/qt5/qtplatformheaders/images/bullet_dn.png
  7727. share/doc/qt5/qtplatformheaders/images/bullet_sq.png
  7728. share/doc/qt5/qtplatformheaders/images/home.png
  7729. share/doc/qt5/qtplatformheaders/images/ico_note.png
  7730. share/doc/qt5/qtplatformheaders/images/ico_note_attention.png
  7731. share/doc/qt5/qtplatformheaders/images/ico_out.png
  7732. share/doc/qt5/qtplatformheaders/images/logo.png
  7733. share/doc/qt5/qtplatformheaders/qcocoanativecontext-members.html
  7734. share/doc/qt5/qtplatformheaders/qcocoanativecontext.html
  7735. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions-members.html
  7736. share/doc/qt5/qtplatformheaders/qcocoawindowfunctions.html
  7737. share/doc/qt5/qtplatformheaders/qeglfsfunctions-members.html
  7738. share/doc/qt5/qtplatformheaders/qeglfsfunctions.html
  7739. share/doc/qt5/qtplatformheaders/qeglnativecontext-members.html
  7740. share/doc/qt5/qtplatformheaders/qeglnativecontext.html
  7741. share/doc/qt5/qtplatformheaders/qglxnativecontext-members.html
  7742. share/doc/qt5/qtplatformheaders/qglxnativecontext.html
  7743. share/doc/qt5/qtplatformheaders/qlinuxfbfunctions-members.html
  7744. share/doc/qt5/qtplatformheaders/qlinuxfbfunctions.html
  7745. share/doc/qt5/qtplatformheaders/qtplatformheaders-index.html
  7746. share/doc/qt5/qtplatformheaders/qtplatformheaders-module.html
  7747. share/doc/qt5/qtplatformheaders/qtplatformheaders.index
  7748. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp
  7749. share/doc/qt5/qtplatformheaders/qtplatformheaders.qhp.sha1
  7750. share/doc/qt5/qtplatformheaders/qwglnativecontext-members.html
  7751. share/doc/qt5/qtplatformheaders/qwglnativecontext.html
  7752. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions-members.html
  7753. share/doc/qt5/qtplatformheaders/qwindowswindowfunctions.html
  7754. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions-members.html
  7755. share/doc/qt5/qtplatformheaders/qxcbwindowfunctions.html
  7756. share/doc/qt5/qtplatformheaders/style/offline-simple.css
  7757. share/doc/qt5/qtplatformheaders/style/offline.css
  7758. share/doc/qt5/qtpositioning.qch
  7759. share/doc/qt5/qtpositioning/examples-manifest.xml
  7760. share/doc/qt5/qtpositioning/images/arrow_bc.png
  7761. share/doc/qt5/qtpositioning/images/bgrContent.png
  7762. share/doc/qt5/qtpositioning/images/btn_next.png
  7763. share/doc/qt5/qtpositioning/images/btn_prev.png
  7764. share/doc/qt5/qtpositioning/images/bullet_dn.png
  7765. share/doc/qt5/qtpositioning/images/bullet_sq.png
  7766. share/doc/qt5/qtpositioning/images/example-satelliteinfo.png
  7767. share/doc/qt5/qtpositioning/images/example-weatherinfo.png
  7768. share/doc/qt5/qtpositioning/images/home.png
  7769. share/doc/qt5/qtpositioning/images/ico_note.png
  7770. share/doc/qt5/qtpositioning/images/ico_note_attention.png
  7771. share/doc/qt5/qtpositioning/images/ico_out.png
  7772. share/doc/qt5/qtpositioning/images/logo.png
  7773. share/doc/qt5/qtpositioning/images/qml-flickr-1.jpg
  7774. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/gloss.png
  7775. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/lineedit.png
  7776. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/moon.png
  7777. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/quit.png
  7778. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/star.png
  7779. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/stripes.png
  7780. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/sun.png
  7781. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/titlebar.png
  7782. share/doc/qt5/qtpositioning/images/used-in-examples/geoflickr/flickrmobile/images/toolbutton.png
  7783. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-few-clouds.png
  7784. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-fog.png
  7785. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-haze.png
  7786. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-icy.png
  7787. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-overcast.png
  7788. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-showers.png
  7789. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sleet.png
  7790. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-snow.png
  7791. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-storm.png
  7792. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny-very-few-clouds.png
  7793. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-sunny.png
  7794. share/doc/qt5/qtpositioning/images/used-in-examples/weatherinfo/icons/weather-thundershower.png
  7795. share/doc/qt5/qtpositioning/location-positioning-cpp.html
  7796. share/doc/qt5/qtpositioning/location-positioning-qml.html
  7797. share/doc/qt5/qtpositioning/positioning-cpp-qml.html
  7798. share/doc/qt5/qtpositioning/qgeoaddress-members.html
  7799. share/doc/qt5/qtpositioning/qgeoaddress.html
  7800. share/doc/qt5/qtpositioning/qgeoareamonitorinfo-members.html
  7801. share/doc/qt5/qtpositioning/qgeoareamonitorinfo.html
  7802. share/doc/qt5/qtpositioning/qgeoareamonitorsource-members.html
  7803. share/doc/qt5/qtpositioning/qgeoareamonitorsource-obsolete.html
  7804. share/doc/qt5/qtpositioning/qgeoareamonitorsource.html
  7805. share/doc/qt5/qtpositioning/qgeocircle-members.html
  7806. share/doc/qt5/qtpositioning/qgeocircle-obsolete.html
  7807. share/doc/qt5/qtpositioning/qgeocircle.html
  7808. share/doc/qt5/qtpositioning/qgeocoordinate-members.html
  7809. share/doc/qt5/qtpositioning/qgeocoordinate.html
  7810. share/doc/qt5/qtpositioning/qgeolocation-members.html
  7811. share/doc/qt5/qtpositioning/qgeolocation.html
  7812. share/doc/qt5/qtpositioning/qgeopath-members.html
  7813. share/doc/qt5/qtpositioning/qgeopath-obsolete.html
  7814. share/doc/qt5/qtpositioning/qgeopath.html
  7815. share/doc/qt5/qtpositioning/qgeopolygon-members.html
  7816. share/doc/qt5/qtpositioning/qgeopolygon-obsolete.html
  7817. share/doc/qt5/qtpositioning/qgeopolygon.html
  7818. share/doc/qt5/qtpositioning/qgeopositioninfo-members.html
  7819. share/doc/qt5/qtpositioning/qgeopositioninfo.html
  7820. share/doc/qt5/qtpositioning/qgeopositioninfosource-members.html
  7821. share/doc/qt5/qtpositioning/qgeopositioninfosource-obsolete.html
  7822. share/doc/qt5/qtpositioning/qgeopositioninfosource.html
  7823. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory-members.html
  7824. share/doc/qt5/qtpositioning/qgeopositioninfosourcefactory.html
  7825. share/doc/qt5/qtpositioning/qgeorectangle-members.html
  7826. share/doc/qt5/qtpositioning/qgeorectangle-obsolete.html
  7827. share/doc/qt5/qtpositioning/qgeorectangle.html
  7828. share/doc/qt5/qtpositioning/qgeosatelliteinfo-members.html
  7829. share/doc/qt5/qtpositioning/qgeosatelliteinfo.html
  7830. share/doc/qt5/qtpositioning/qgeosatelliteinfosource-members.html
  7831. share/doc/qt5/qtpositioning/qgeosatelliteinfosource-obsolete.html
  7832. share/doc/qt5/qtpositioning/qgeosatelliteinfosource.html
  7833. share/doc/qt5/qtpositioning/qgeoshape-members.html
  7834. share/doc/qt5/qtpositioning/qgeoshape-obsolete.html
  7835. share/doc/qt5/qtpositioning/qgeoshape.html
  7836. share/doc/qt5/qtpositioning/qml-coordinate.html
  7837. share/doc/qt5/qtpositioning/qml-geocircle.html
  7838. share/doc/qt5/qtpositioning/qml-geopath.html
  7839. share/doc/qt5/qtpositioning/qml-geopolygon.html
  7840. share/doc/qt5/qtpositioning/qml-georectangle.html
  7841. share/doc/qt5/qtpositioning/qml-geoshape.html
  7842. share/doc/qt5/qtpositioning/qml-qtpositioning-address-members.html
  7843. share/doc/qt5/qtpositioning/qml-qtpositioning-address.html
  7844. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
  7845. share/doc/qt5/qtpositioning/qml-qtpositioning-coordinateanimation.html
  7846. share/doc/qt5/qtpositioning/qml-qtpositioning-location-members.html
  7847. share/doc/qt5/qtpositioning/qml-qtpositioning-location.html
  7848. share/doc/qt5/qtpositioning/qml-qtpositioning-position-members.html
  7849. share/doc/qt5/qtpositioning/qml-qtpositioning-position.html
  7850. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource-members.html
  7851. share/doc/qt5/qtpositioning/qml-qtpositioning-positionsource.html
  7852. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning-members.html
  7853. share/doc/qt5/qtpositioning/qml-qtpositioning-qtpositioning.html
  7854. share/doc/qt5/qtpositioning/qnmeapositioninfosource-members.html
  7855. share/doc/qt5/qtpositioning/qnmeapositioninfosource-obsolete.html
  7856. share/doc/qt5/qtpositioning/qnmeapositioninfosource.html
  7857. share/doc/qt5/qtpositioning/qtpositioning-attribution-weatherinfo-tango-icons.html
  7858. share/doc/qt5/qtpositioning/qtpositioning-attribution-weatherinfo-tango-weather-pack.html
  7859. share/doc/qt5/qtpositioning/qtpositioning-examples.html
  7860. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-example.html
  7861. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-90-qml.html
  7862. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qml.html
  7863. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickr-qrc.html
  7864. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-progress-qml.html
  7865. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-restmodel-qml.html
  7866. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-scrollbar-qml.html
  7867. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrcommon-slider-qml.html
  7868. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-button-qml.html
  7869. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-geotab-qml.html
  7870. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-griddelegate-qml.html
  7871. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-imagedetails-qml.html
  7872. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-listdelegate-qml.html
  7873. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-titlebar-qml.html
  7874. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-flickrmobile-toolbar-qml.html
  7875. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-pro.html
  7876. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-geoflickr-qmlproject.html
  7877. share/doc/qt5/qtpositioning/qtpositioning-geoflickr-qmllocationflickr-cpp.html
  7878. share/doc/qt5/qtpositioning/qtpositioning-index.html
  7879. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-cpp.html
  7880. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-clientapplication-h.html
  7881. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-example.html
  7882. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfile-qrc.html
  7883. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-cpp.html
  7884. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-h.html
  7885. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-logfilepositionsource-pro.html
  7886. share/doc/qt5/qtpositioning/qtpositioning-logfilepositionsource-main-cpp.html
  7887. share/doc/qt5/qtpositioning/qtpositioning-module.html
  7888. share/doc/qt5/qtpositioning/qtpositioning-plugins.html
  7889. share/doc/qt5/qtpositioning/qtpositioning-qmlmodule.html
  7890. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-example.html
  7891. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-main-cpp.html
  7892. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-pro.html
  7893. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qml.html
  7894. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satelliteinfo-qrc.html
  7895. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-cpp.html
  7896. share/doc/qt5/qtpositioning/qtpositioning-satelliteinfo-satellitemodel-h.html
  7897. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-cpp.html
  7898. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-appmodel-h.html
  7899. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-bigforecasticon-qml.html
  7900. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-forecasticon-qml.html
  7901. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-components-weathericon-qml.html
  7902. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-example.html
  7903. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-main-cpp.html
  7904. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-pro.html
  7905. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qml.html
  7906. share/doc/qt5/qtpositioning/qtpositioning-weatherinfo-weatherinfo-qrc.html
  7907. share/doc/qt5/qtpositioning/qtpositioning.index
  7908. share/doc/qt5/qtpositioning/qtpositioning.qhp
  7909. share/doc/qt5/qtpositioning/qtpositioning.qhp.sha1
  7910. share/doc/qt5/qtpositioning/qtpositioning.tags
  7911. share/doc/qt5/qtpositioning/style/offline-simple.css
  7912. share/doc/qt5/qtpositioning/style/offline.css
  7913. share/doc/qt5/qtprintsupport.qch
  7914. share/doc/qt5/qtprintsupport/images/arrow_bc.png
  7915. share/doc/qt5/qtprintsupport/images/bgrContent.png
  7916. share/doc/qt5/qtprintsupport/images/btn_next.png
  7917. share/doc/qt5/qtprintsupport/images/btn_prev.png
  7918. share/doc/qt5/qtprintsupport/images/bullet_dn.png
  7919. share/doc/qt5/qtprintsupport/images/bullet_sq.png
  7920. share/doc/qt5/qtprintsupport/images/home.png
  7921. share/doc/qt5/qtprintsupport/images/ico_note.png
  7922. share/doc/qt5/qtprintsupport/images/ico_note_attention.png
  7923. share/doc/qt5/qtprintsupport/images/ico_out.png
  7924. share/doc/qt5/qtprintsupport/images/logo.png
  7925. share/doc/qt5/qtprintsupport/images/plastique-printdialog-properties.png
  7926. share/doc/qt5/qtprintsupport/images/plastique-printdialog.png
  7927. share/doc/qt5/qtprintsupport/images/printer-rects.png
  7928. share/doc/qt5/qtprintsupport/pdf-licensing.html
  7929. share/doc/qt5/qtprintsupport/printing.html
  7930. share/doc/qt5/qtprintsupport/qabstractprintdialog-members.html
  7931. share/doc/qt5/qtprintsupport/qabstractprintdialog-obsolete.html
  7932. share/doc/qt5/qtprintsupport/qabstractprintdialog.html
  7933. share/doc/qt5/qtprintsupport/qpagesetupdialog-members.html
  7934. share/doc/qt5/qtprintsupport/qpagesetupdialog-obsolete.html
  7935. share/doc/qt5/qtprintsupport/qpagesetupdialog.html
  7936. share/doc/qt5/qtprintsupport/qprintdialog-members.html
  7937. share/doc/qt5/qtprintsupport/qprintdialog-obsolete.html
  7938. share/doc/qt5/qtprintsupport/qprintdialog.html
  7939. share/doc/qt5/qtprintsupport/qprintengine-members.html
  7940. share/doc/qt5/qtprintsupport/qprintengine.html
  7941. share/doc/qt5/qtprintsupport/qprinter-members.html
  7942. share/doc/qt5/qtprintsupport/qprinter-obsolete.html
  7943. share/doc/qt5/qtprintsupport/qprinter.html
  7944. share/doc/qt5/qtprintsupport/qprinterinfo-members.html
  7945. share/doc/qt5/qtprintsupport/qprinterinfo-obsolete.html
  7946. share/doc/qt5/qtprintsupport/qprinterinfo.html
  7947. share/doc/qt5/qtprintsupport/qprintpreviewdialog-members.html
  7948. share/doc/qt5/qtprintsupport/qprintpreviewdialog-obsolete.html
  7949. share/doc/qt5/qtprintsupport/qprintpreviewdialog.html
  7950. share/doc/qt5/qtprintsupport/qprintpreviewwidget-members.html
  7951. share/doc/qt5/qtprintsupport/qprintpreviewwidget-obsolete.html
  7952. share/doc/qt5/qtprintsupport/qprintpreviewwidget.html
  7953. share/doc/qt5/qtprintsupport/qtprintsupport-index.html
  7954. share/doc/qt5/qtprintsupport/qtprintsupport-module.html
  7955. share/doc/qt5/qtprintsupport/qtprintsupport.index
  7956. share/doc/qt5/qtprintsupport/qtprintsupport.qhp
  7957. share/doc/qt5/qtprintsupport/qtprintsupport.qhp.sha1
  7958. share/doc/qt5/qtprintsupport/qtprintsupport.tags
  7959. share/doc/qt5/qtprintsupport/style/offline-simple.css
  7960. share/doc/qt5/qtprintsupport/style/offline.css
  7961. share/doc/qt5/qtqml.qch
  7962. share/doc/qt5/qtqml/examples-manifest.xml
  7963. share/doc/qt5/qtqml/images/arrow_bc.png
  7964. share/doc/qt5/qtqml/images/bgrContent.png
  7965. share/doc/qt5/qtqml/images/btn_next.png
  7966. share/doc/qt5/qtqml/images/btn_prev.png
  7967. share/doc/qt5/qtqml/images/bullet_dn.png
  7968. share/doc/qt5/qtqml/images/bullet_sq.png
  7969. share/doc/qt5/qtqml/images/button-types.png
  7970. share/doc/qt5/qtqml/images/cpp-qml-integration-flowchart.png
  7971. share/doc/qt5/qtqml/images/cppintegration-ex.png
  7972. share/doc/qt5/qtqml/images/declarative-rect_tint.png
  7973. share/doc/qt5/qtqml/images/documents-definetypes-attributes.png
  7974. share/doc/qt5/qtqml/images/documents-definetypes-simple.png
  7975. share/doc/qt5/qtqml/images/extending-tutorial-chapter1.png
  7976. share/doc/qt5/qtqml/images/extending-tutorial-chapter2.png
  7977. share/doc/qt5/qtqml/images/extending-tutorial-chapter3.png
  7978. share/doc/qt5/qtqml/images/extending-tutorial-chapter5.png
  7979. share/doc/qt5/qtqml/images/home.png
  7980. share/doc/qt5/qtqml/images/ico_note.png
  7981. share/doc/qt5/qtqml/images/ico_note_attention.png
  7982. share/doc/qt5/qtqml/images/ico_out.png
  7983. share/doc/qt5/qtqml/images/listmodel-nested.png
  7984. share/doc/qt5/qtqml/images/listmodel.png
  7985. share/doc/qt5/qtqml/images/logo.png
  7986. share/doc/qt5/qtqml/images/objectmodel.png
  7987. share/doc/qt5/qtqml/images/qml-dynamicscene-example.png
  7988. share/doc/qt5/qtqml/images/qml-i18n-example.png
  7989. share/doc/qt5/qtqml/images/qml-plugins-example.png
  7990. share/doc/qt5/qtqml/images/qml-xmlhttprequest-example.png
  7991. share/doc/qt5/qtqml/images/qtqml-syntax-basics-object-declaration.png
  7992. share/doc/qt5/qtqml/images/statemachine-button-history.png
  7993. share/doc/qt5/qtqml/images/statemachine-button-nested.png
  7994. share/doc/qt5/qtqml/images/statemachine-button.png
  7995. share/doc/qt5/qtqml/images/statemachine-finished.png
  7996. share/doc/qt5/qtqml/images/statemachine-nonparallel.png
  7997. share/doc/qt5/qtqml/images/statemachine-parallel.png
  7998. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/face-smile.png
  7999. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/moon.png
  8000. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_brown.png
  8001. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/rabbit_bw.png
  8002. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/star.png
  8003. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/sun.png
  8004. share/doc/qt5/qtqml/images/used-in-examples/dynamicscene/content/images/tree_s.png
  8005. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/center.png
  8006. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/clock.png
  8007. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/hour.png
  8008. share/doc/qt5/qtqml/images/used-in-examples/qmlextensionplugins/imports/TimeExample/minute.png
  8009. share/doc/qt5/qtqml/qjsengine-members.html
  8010. share/doc/qt5/qtqml/qjsengine-obsolete.html
  8011. share/doc/qt5/qtqml/qjsengine.html
  8012. share/doc/qt5/qtqml/qjsvalue-members.html
  8013. share/doc/qt5/qtqml/qjsvalue-obsolete.html
  8014. share/doc/qt5/qtqml/qjsvalue.html
  8015. share/doc/qt5/qtqml/qjsvalueiterator-members.html
  8016. share/doc/qt5/qtqml/qjsvalueiterator.html
  8017. share/doc/qt5/qtqml/qml-bool.html
  8018. share/doc/qt5/qtqml/qml-date.html
  8019. share/doc/qt5/qtqml/qml-double.html
  8020. share/doc/qt5/qtqml/qml-enumeration.html
  8021. share/doc/qt5/qtqml/qml-int.html
  8022. share/doc/qt5/qtqml/qml-list.html
  8023. share/doc/qt5/qtqml/qml-package-members.html
  8024. share/doc/qt5/qtqml/qml-package.html
  8025. share/doc/qt5/qtqml/qml-point.html
  8026. share/doc/qt5/qtqml/qml-qt-labs-qmlmodels-delegatechoice-members.html
  8027. share/doc/qt5/qtqml/qml-qt-labs-qmlmodels-delegatechoice.html
  8028. share/doc/qt5/qtqml/qml-qt-labs-qmlmodels-delegatechooser-members.html
  8029. share/doc/qt5/qtqml/qml-qt-labs-qmlmodels-delegatechooser.html
  8030. share/doc/qt5/qtqml/qml-qtqml-binding-members.html
  8031. share/doc/qt5/qtqml/qml-qtqml-binding.html
  8032. share/doc/qt5/qtqml/qml-qtqml-component-members.html
  8033. share/doc/qt5/qtqml/qml-qtqml-component.html
  8034. share/doc/qt5/qtqml/qml-qtqml-connections-members.html
  8035. share/doc/qt5/qtqml/qml-qtqml-connections.html
  8036. share/doc/qt5/qtqml/qml-qtqml-date-members.html
  8037. share/doc/qt5/qtqml/qml-qtqml-date.html
  8038. share/doc/qt5/qtqml/qml-qtqml-instantiator-members.html
  8039. share/doc/qt5/qtqml/qml-qtqml-instantiator.html
  8040. share/doc/qt5/qtqml/qml-qtqml-locale-members.html
  8041. share/doc/qt5/qtqml/qml-qtqml-locale.html
  8042. share/doc/qt5/qtqml/qml-qtqml-loggingcategory-members.html
  8043. share/doc/qt5/qtqml/qml-qtqml-loggingcategory.html
  8044. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel-members.html
  8045. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodel.html
  8046. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
  8047. share/doc/qt5/qtqml/qml-qtqml-models-delegatemodelgroup.html
  8048. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel-members.html
  8049. share/doc/qt5/qtqml/qml-qtqml-models-itemselectionmodel.html
  8050. share/doc/qt5/qtqml/qml-qtqml-models-listelement-members.html
  8051. share/doc/qt5/qtqml/qml-qtqml-models-listelement.html
  8052. share/doc/qt5/qtqml/qml-qtqml-models-listmodel-members.html
  8053. share/doc/qt5/qtqml/qml-qtqml-models-listmodel.html
  8054. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel-members.html
  8055. share/doc/qt5/qtqml/qml-qtqml-models-objectmodel.html
  8056. share/doc/qt5/qtqml/qml-qtqml-number-members.html
  8057. share/doc/qt5/qtqml/qml-qtqml-number.html
  8058. share/doc/qt5/qtqml/qml-qtqml-qt-members.html
  8059. share/doc/qt5/qtqml/qml-qtqml-qt.html
  8060. share/doc/qt5/qtqml/qml-qtqml-qtobject-members.html
  8061. share/doc/qt5/qtqml/qml-qtqml-qtobject.html
  8062. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate-members.html
  8063. share/doc/qt5/qtqml/qml-qtqml-statemachine-finalstate.html
  8064. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate-members.html
  8065. share/doc/qt5/qtqml/qml-qtqml-statemachine-historystate.html
  8066. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
  8067. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstractstate.html
  8068. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
  8069. share/doc/qt5/qtqml/qml-qtqml-statemachine-qabstracttransition.html
  8070. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
  8071. share/doc/qt5/qtqml/qml-qtqml-statemachine-qsignaltransition.html
  8072. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition-members.html
  8073. share/doc/qt5/qtqml/qml-qtqml-statemachine-signaltransition.html
  8074. share/doc/qt5/qtqml/qml-qtqml-statemachine-state-members.html
  8075. share/doc/qt5/qtqml/qml-qtqml-statemachine-state.html
  8076. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine-members.html
  8077. share/doc/qt5/qtqml/qml-qtqml-statemachine-statemachine.html
  8078. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
  8079. share/doc/qt5/qtqml/qml-qtqml-statemachine-timeouttransition.html
  8080. share/doc/qt5/qtqml/qml-qtqml-string-members.html
  8081. share/doc/qt5/qtqml/qml-qtqml-string.html
  8082. share/doc/qt5/qtqml/qml-qtqml-timer-members.html
  8083. share/doc/qt5/qtqml/qml-qtqml-timer.html
  8084. share/doc/qt5/qtqml/qml-real.html
  8085. share/doc/qt5/qtqml/qml-rect.html
  8086. share/doc/qt5/qtqml/qml-size.html
  8087. share/doc/qt5/qtqml/qml-string.html
  8088. share/doc/qt5/qtqml/qml-url.html
  8089. share/doc/qt5/qtqml/qml-var.html
  8090. share/doc/qt5/qtqml/qml-variant.html
  8091. share/doc/qt5/qtqml/qml-workerscript-members.html
  8092. share/doc/qt5/qtqml/qml-workerscript.html
  8093. share/doc/qt5/qtqml/qmlextendingexamples.html
  8094. share/doc/qt5/qtqml/qmlreference.html
  8095. share/doc/qt5/qtqml/qmlstatemachine.html
  8096. share/doc/qt5/qtqml/qmodelindex-and-related-classes-in-qml.html
  8097. share/doc/qt5/qtqml/qqmlabstracturlinterceptor-members.html
  8098. share/doc/qt5/qtqml/qqmlabstracturlinterceptor.html
  8099. share/doc/qt5/qtqml/qqmlapplicationengine-members.html
  8100. share/doc/qt5/qtqml/qqmlapplicationengine-obsolete.html
  8101. share/doc/qt5/qtqml/qqmlapplicationengine.html
  8102. share/doc/qt5/qtqml/qqmlcomponent-members.html
  8103. share/doc/qt5/qtqml/qqmlcomponent-obsolete.html
  8104. share/doc/qt5/qtqml/qqmlcomponent.html
  8105. share/doc/qt5/qtqml/qqmlcontext-members.html
  8106. share/doc/qt5/qtqml/qqmlcontext-obsolete.html
  8107. share/doc/qt5/qtqml/qqmlcontext-propertypair-members.html
  8108. share/doc/qt5/qtqml/qqmlcontext-propertypair.html
  8109. share/doc/qt5/qtqml/qqmlcontext.html
  8110. share/doc/qt5/qtqml/qqmlengine-members.html
  8111. share/doc/qt5/qtqml/qqmlengine-obsolete.html
  8112. share/doc/qt5/qtqml/qqmlengine.html
  8113. share/doc/qt5/qtqml/qqmlerror-members.html
  8114. share/doc/qt5/qtqml/qqmlerror.html
  8115. share/doc/qt5/qtqml/qqmlexpression-members.html
  8116. share/doc/qt5/qtqml/qqmlexpression-obsolete.html
  8117. share/doc/qt5/qtqml/qqmlexpression.html
  8118. share/doc/qt5/qtqml/qqmlextensionplugin-members.html
  8119. share/doc/qt5/qtqml/qqmlextensionplugin-obsolete.html
  8120. share/doc/qt5/qtqml/qqmlextensionplugin.html
  8121. share/doc/qt5/qtqml/qqmlfileselector-members.html
  8122. share/doc/qt5/qtqml/qqmlfileselector-obsolete.html
  8123. share/doc/qt5/qtqml/qqmlfileselector.html
  8124. share/doc/qt5/qtqml/qqmlimageproviderbase-members.html
  8125. share/doc/qt5/qtqml/qqmlimageproviderbase.html
  8126. share/doc/qt5/qtqml/qqmlincubationcontroller-members.html
  8127. share/doc/qt5/qtqml/qqmlincubationcontroller.html
  8128. share/doc/qt5/qtqml/qqmlincubator-members.html
  8129. share/doc/qt5/qtqml/qqmlincubator.html
  8130. share/doc/qt5/qtqml/qqmllistproperty-members.html
  8131. share/doc/qt5/qtqml/qqmllistproperty.html
  8132. share/doc/qt5/qtqml/qqmllistreference-members.html
  8133. share/doc/qt5/qtqml/qqmllistreference.html
  8134. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory-members.html
  8135. share/doc/qt5/qtqml/qqmlnetworkaccessmanagerfactory.html
  8136. share/doc/qt5/qtqml/qqmlparserstatus-members.html
  8137. share/doc/qt5/qtqml/qqmlparserstatus.html
  8138. share/doc/qt5/qtqml/qqmlproperty-members.html
  8139. share/doc/qt5/qtqml/qqmlproperty.html
  8140. share/doc/qt5/qtqml/qqmlpropertymap-members.html
  8141. share/doc/qt5/qtqml/qqmlpropertymap-obsolete.html
  8142. share/doc/qt5/qtqml/qqmlpropertymap.html
  8143. share/doc/qt5/qtqml/qqmlpropertyvaluesource-members.html
  8144. share/doc/qt5/qtqml/qqmlpropertyvaluesource.html
  8145. share/doc/qt5/qtqml/qqmlscriptstring-members.html
  8146. share/doc/qt5/qtqml/qqmlscriptstring.html
  8147. share/doc/qt5/qtqml/qt-labs-qmlmodels-qmlmodule.html
  8148. share/doc/qt5/qtqml/qtjavascript.html
  8149. share/doc/qt5/qtqml/qtqml-attribution-masm.html
  8150. share/doc/qt5/qtqml/qtqml-cppclasses-topic.html
  8151. share/doc/qt5/qtqml/qtqml-cppintegration-contextproperties.html
  8152. share/doc/qt5/qtqml/qtqml-cppintegration-data.html
  8153. share/doc/qt5/qtqml/qtqml-cppintegration-definetypes.html
  8154. share/doc/qt5/qtqml/qtqml-cppintegration-exposecppattributes.html
  8155. share/doc/qt5/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
  8156. share/doc/qt5/qtqml/qtqml-cppintegration-overview.html
  8157. share/doc/qt5/qtqml/qtqml-cppintegration-topic.html
  8158. share/doc/qt5/qtqml/qtqml-documents-definetypes.html
  8159. share/doc/qt5/qtqml/qtqml-documents-networktransparency.html
  8160. share/doc/qt5/qtqml/qtqml-documents-scope.html
  8161. share/doc/qt5/qtqml/qtqml-documents-structure.html
  8162. share/doc/qt5/qtqml/qtqml-documents-topic.html
  8163. share/doc/qt5/qtqml/qtqml-dynamicscene-content-button-qml.html
  8164. share/doc/qt5/qtqml/qtqml-dynamicscene-content-genericsceneitem-qml.html
  8165. share/doc/qt5/qtqml/qtqml-dynamicscene-content-itemcreation-js.html
  8166. share/doc/qt5/qtqml/qtqml-dynamicscene-content-paletteitem-qml.html
  8167. share/doc/qt5/qtqml/qtqml-dynamicscene-content-perspectiveitem-qml.html
  8168. share/doc/qt5/qtqml/qtqml-dynamicscene-content-sun-qml.html
  8169. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qml.html
  8170. share/doc/qt5/qtqml/qtqml-dynamicscene-dynamicscene-qmlproject.html
  8171. share/doc/qt5/qtqml/qtqml-dynamicscene-example.html
  8172. share/doc/qt5/qtqml/qtqml-index.html
  8173. share/doc/qt5/qtqml/qtqml-javascript-dynamicobjectcreation.html
  8174. share/doc/qt5/qtqml/qtqml-javascript-expressions.html
  8175. share/doc/qt5/qtqml/qtqml-javascript-functionlist.html
  8176. share/doc/qt5/qtqml/qtqml-javascript-hostenvironment.html
  8177. share/doc/qt5/qtqml/qtqml-javascript-imports.html
  8178. share/doc/qt5/qtqml/qtqml-javascript-qmlglobalobject.html
  8179. share/doc/qt5/qtqml/qtqml-javascript-resources.html
  8180. share/doc/qt5/qtqml/qtqml-javascript-topic.html
  8181. share/doc/qt5/qtqml/qtqml-models-qmlmodule.html
  8182. share/doc/qt5/qtqml/qtqml-module.html
  8183. share/doc/qt5/qtqml/qtqml-modules-cppplugins.html
  8184. share/doc/qt5/qtqml/qtqml-modules-identifiedmodules.html
  8185. share/doc/qt5/qtqml/qtqml-modules-legacymodules.html
  8186. share/doc/qt5/qtqml/qtqml-modules-qmldir.html
  8187. share/doc/qt5/qtqml/qtqml-modules-topic.html
  8188. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-example.html
  8189. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-main-cpp.html
  8190. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-pro.html
  8191. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qmlproject.html
  8192. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-networkaccessmanagerfactory-qrc.html
  8193. share/doc/qt5/qtqml/qtqml-networkaccessmanagerfactory-view-qml.html
  8194. share/doc/qt5/qtqml/qtqml-qml-i18n-example.html
  8195. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qml.html
  8196. share/doc/qt5/qtqml/qtqml-qml-i18n-qml-i18n-qmlproject.html
  8197. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-example.html
  8198. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-clock-qml.html
  8199. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-imports-timeexample-qmldir.html
  8200. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugin-cpp.html
  8201. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qml.html
  8202. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-plugins-qmlproject.html
  8203. share/doc/qt5/qtqml/qtqml-qmlextensionplugins-qmlextensionplugins-pro.html
  8204. share/doc/qt5/qtqml/qtqml-qmlmodule.html
  8205. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-pro.html
  8206. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-adding-qrc.html
  8207. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example-qml.html
  8208. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-example.html
  8209. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-main-cpp.html
  8210. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-cpp.html
  8211. share/doc/qt5/qtqml/qtqml-referenceexamples-adding-person-h.html
  8212. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-pro.html
  8213. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-attached-qrc.html
  8214. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-cpp.html
  8215. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-birthdayparty-h.html
  8216. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example-qml.html
  8217. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-example.html
  8218. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-main-cpp.html
  8219. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-cpp.html
  8220. share/doc/qt5/qtqml/qtqml-referenceexamples-attached-person-h.html
  8221. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-pro.html
  8222. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-binding-qrc.html
  8223. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-cpp.html
  8224. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-birthdayparty-h.html
  8225. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example-qml.html
  8226. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-example.html
  8227. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-cpp.html
  8228. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-happybirthdaysong-h.html
  8229. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-main-cpp.html
  8230. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-cpp.html
  8231. share/doc/qt5/qtqml/qtqml-referenceexamples-binding-person-h.html
  8232. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-cpp.html
  8233. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-birthdayparty-h.html
  8234. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-pro.html
  8235. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-coercion-qrc.html
  8236. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example-qml.html
  8237. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-example.html
  8238. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-main-cpp.html
  8239. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-cpp.html
  8240. share/doc/qt5/qtqml/qtqml-referenceexamples-coercion-person-h.html
  8241. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-cpp.html
  8242. share/doc/qt5/qtqml/qtqml-referenceexamples-default-birthdayparty-h.html
  8243. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-pro.html
  8244. share/doc/qt5/qtqml/qtqml-referenceexamples-default-default-qrc.html
  8245. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example-qml.html
  8246. share/doc/qt5/qtqml/qtqml-referenceexamples-default-example.html
  8247. share/doc/qt5/qtqml/qtqml-referenceexamples-default-main-cpp.html
  8248. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-cpp.html
  8249. share/doc/qt5/qtqml/qtqml-referenceexamples-default-person-h.html
  8250. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example-qml.html
  8251. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-example.html
  8252. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-pro.html
  8253. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-extended-qrc.html
  8254. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-cpp.html
  8255. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-lineedit-h.html
  8256. share/doc/qt5/qtqml/qtqml-referenceexamples-extended-main-cpp.html
  8257. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-cpp.html
  8258. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-birthdayparty-h.html
  8259. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example-qml.html
  8260. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-example.html
  8261. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-pro.html
  8262. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-grouped-qrc.html
  8263. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-main-cpp.html
  8264. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-cpp.html
  8265. share/doc/qt5/qtqml/qtqml-referenceexamples-grouped-person-h.html
  8266. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-cpp.html
  8267. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-birthdayparty-h.html
  8268. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example-qml.html
  8269. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-example.html
  8270. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-main-cpp.html
  8271. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-pro.html
  8272. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-methods-qrc.html
  8273. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-cpp.html
  8274. share/doc/qt5/qtqml/qtqml-referenceexamples-methods-person-h.html
  8275. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-cpp.html
  8276. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-birthdayparty-h.html
  8277. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example-qml.html
  8278. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-example.html
  8279. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-main-cpp.html
  8280. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-cpp.html
  8281. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-person-h.html
  8282. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-pro.html
  8283. share/doc/qt5/qtqml/qtqml-referenceexamples-properties-properties-qrc.html
  8284. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-cpp.html
  8285. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-birthdayparty-h.html
  8286. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example-qml.html
  8287. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-example.html
  8288. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-main-cpp.html
  8289. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-cpp.html
  8290. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-person-h.html
  8291. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-pro.html
  8292. share/doc/qt5/qtqml/qtqml-referenceexamples-signal-signal-qrc.html
  8293. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-cpp.html
  8294. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-birthdayparty-h.html
  8295. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example-qml.html
  8296. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-example.html
  8297. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-cpp.html
  8298. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-happybirthdaysong-h.html
  8299. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-main-cpp.html
  8300. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-cpp.html
  8301. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-person-h.html
  8302. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-pro.html
  8303. share/doc/qt5/qtqml/qtqml-referenceexamples-valuesource-valuesource-qrc.html
  8304. share/doc/qt5/qtqml/qtqml-statemachine-qmlmodule.html
  8305. share/doc/qt5/qtqml/qtqml-syntax-basics.html
  8306. share/doc/qt5/qtqml/qtqml-syntax-directoryimports.html
  8307. share/doc/qt5/qtqml/qtqml-syntax-imports.html
  8308. share/doc/qt5/qtqml/qtqml-syntax-objectattributes.html
  8309. share/doc/qt5/qtqml/qtqml-syntax-propertybinding.html
  8310. share/doc/qt5/qtqml/qtqml-syntax-signals.html
  8311. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-app-qml.html
  8312. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-pro.html
  8313. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-chapter1-basics-qrc.html
  8314. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-main-cpp.html
  8315. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-cpp.html
  8316. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter1-basics-piechart-h.html
  8317. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-app-qml.html
  8318. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-pro.html
  8319. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-chapter2-methods-qrc.html
  8320. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-cpp.html
  8321. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter2-methods-piechart-h.html
  8322. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-app-qml.html
  8323. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-pro.html
  8324. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-chapter3-bindings-qrc.html
  8325. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-cpp.html
  8326. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter3-bindings-piechart-h.html
  8327. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-app-qml.html
  8328. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-pro.html
  8329. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-chapter4-custompropertytypes-qrc.html
  8330. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-cpp.html
  8331. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-piechart-h.html
  8332. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-cpp.html
  8333. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter4-custompropertytypes-pieslice-h.html
  8334. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-app-qml.html
  8335. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-pro.html
  8336. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-chapter5-listproperties-qrc.html
  8337. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-cpp.html
  8338. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-piechart-h.html
  8339. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-cpp.html
  8340. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter5-listproperties-pieslice-h.html
  8341. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-pro.html
  8342. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qml.html
  8343. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-app-qrc.html
  8344. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-chapter6-plugins-pro.html
  8345. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-cpp.html
  8346. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-chartsplugin-h.html
  8347. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-import-pro.html
  8348. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-cpp.html
  8349. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-piechart-h.html
  8350. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-cpp.html
  8351. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-pieslice-h.html
  8352. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-chapter6-plugins-import-qmldir.html
  8353. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-example.html
  8354. share/doc/qt5/qtqml/qtqml-tutorials-extending-qml-extending-qml-pro.html
  8355. share/doc/qt5/qtqml/qtqml-typesystem-basictypes.html
  8356. share/doc/qt5/qtqml/qtqml-typesystem-objecttypes.html
  8357. share/doc/qt5/qtqml/qtqml-typesystem-topic.html
  8358. share/doc/qt5/qtqml/qtqml-xmlhttprequest-data-xml.html
  8359. share/doc/qt5/qtqml/qtqml-xmlhttprequest-example.html
  8360. share/doc/qt5/qtqml/qtqml-xmlhttprequest-get-qml.html
  8361. share/doc/qt5/qtqml/qtqml-xmlhttprequest-getform-ui-qml.html
  8362. share/doc/qt5/qtqml/qtqml-xmlhttprequest-main-cpp.html
  8363. share/doc/qt5/qtqml/qtqml-xmlhttprequest-methods-js.html
  8364. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-pro.html
  8365. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qml.html
  8366. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qmlproject.html
  8367. share/doc/qt5/qtqml/qtqml-xmlhttprequest-xmlhttprequest-qrc.html
  8368. share/doc/qt5/qtqml/qtqml.html
  8369. share/doc/qt5/qtqml/qtqml.index
  8370. share/doc/qt5/qtqml/qtqml.qhp
  8371. share/doc/qt5/qtqml/qtqml.qhp.sha1
  8372. share/doc/qt5/qtqml/qtqml.tags
  8373. share/doc/qt5/qtqml/style/offline-simple.css
  8374. share/doc/qt5/qtqml/style/offline.css
  8375. share/doc/qt5/qtqmltest.qch
  8376. share/doc/qt5/qtqmltest/images/arrow_bc.png
  8377. share/doc/qt5/qtqmltest/images/bgrContent.png
  8378. share/doc/qt5/qtqmltest/images/btn_next.png
  8379. share/doc/qt5/qtqmltest/images/btn_prev.png
  8380. share/doc/qt5/qtqmltest/images/bullet_dn.png
  8381. share/doc/qt5/qtqmltest/images/bullet_sq.png
  8382. share/doc/qt5/qtqmltest/images/home.png
  8383. share/doc/qt5/qtqmltest/images/ico_note.png
  8384. share/doc/qt5/qtqmltest/images/ico_note_attention.png
  8385. share/doc/qt5/qtqmltest/images/ico_out.png
  8386. share/doc/qt5/qtqmltest/images/logo.png
  8387. share/doc/qt5/qtqmltest/qtqmltest.index
  8388. share/doc/qt5/qtqmltest/qtqmltest.qhp
  8389. share/doc/qt5/qtqmltest/qtqmltest.qhp.sha1
  8390. share/doc/qt5/qtqmltest/qtqmltest.tags
  8391. share/doc/qt5/qtqmltest/qtquicktest-index.html
  8392. share/doc/qt5/qtqmltest/style/offline-simple.css
  8393. share/doc/qt5/qtqmltest/style/offline.css
  8394. share/doc/qt5/qtquick.qch
  8395. share/doc/qt5/qtquick/examples-manifest.xml
  8396. share/doc/qt5/qtquick/images/3d-rotation-axis.png
  8397. share/doc/qt5/qtquick/images/9BcAYDlpuT8.jpg
  8398. share/doc/qt5/qtquick/images/ListViewHorizontal.png
  8399. share/doc/qt5/qtquick/images/anchor_ordering.png
  8400. share/doc/qt5/qtquick/images/anchor_ordering_bad.png
  8401. share/doc/qt5/qtquick/images/anchorchanges.png
  8402. share/doc/qt5/qtquick/images/animatedimageitem.gif
  8403. share/doc/qt5/qtquick/images/animatedsprite-loading-frames.png
  8404. share/doc/qt5/qtquick/images/animatedsprite-loading-interpolated.gif
  8405. share/doc/qt5/qtquick/images/animatedsprite-loading.gif
  8406. share/doc/qt5/qtquick/images/animatedsprite-loading.png
  8407. share/doc/qt5/qtquick/images/arrow_bc.png
  8408. share/doc/qt5/qtquick/images/axisrotation.png
  8409. share/doc/qt5/qtquick/images/bgrContent.png
  8410. share/doc/qt5/qtquick/images/btn_next.png
  8411. share/doc/qt5/qtquick/images/btn_prev.png
  8412. share/doc/qt5/qtquick/images/bullet_dn.png
  8413. share/doc/qt5/qtquick/images/bullet_sq.png
  8414. share/doc/qt5/qtquick/images/columnlayout.png
  8415. share/doc/qt5/qtquick/images/custom-geometry-example.png
  8416. share/doc/qt5/qtquick/images/declarative-adv-tutorial1.png
  8417. share/doc/qt5/qtquick/images/declarative-adv-tutorial2.png
  8418. share/doc/qt5/qtquick/images/declarative-adv-tutorial3.png
  8419. share/doc/qt5/qtquick/images/declarative-adv-tutorial4.gif
  8420. share/doc/qt5/qtquick/images/declarative-anchors_example.png
  8421. share/doc/qt5/qtquick/images/declarative-anchors_example2.png
  8422. share/doc/qt5/qtquick/images/declarative-arcdirection.png
  8423. share/doc/qt5/qtquick/images/declarative-arcradius.png
  8424. share/doc/qt5/qtquick/images/declarative-arcrotation.png
  8425. share/doc/qt5/qtquick/images/declarative-colors.png
  8426. share/doc/qt5/qtquick/images/declarative-gridmesh.png
  8427. share/doc/qt5/qtquick/images/declarative-item_opacity1.png
  8428. share/doc/qt5/qtquick/images/declarative-item_opacity2.png
  8429. share/doc/qt5/qtquick/images/declarative-item_stacking1.png
  8430. share/doc/qt5/qtquick/images/declarative-item_stacking2.png
  8431. share/doc/qt5/qtquick/images/declarative-item_stacking3.png
  8432. share/doc/qt5/qtquick/images/declarative-item_stacking4.png
  8433. share/doc/qt5/qtquick/images/declarative-largearc.png
  8434. share/doc/qt5/qtquick/images/declarative-nopercent.png
  8435. share/doc/qt5/qtquick/images/declarative-patharc.png
  8436. share/doc/qt5/qtquick/images/declarative-pathattribute.png
  8437. share/doc/qt5/qtquick/images/declarative-pathcubic.png
  8438. share/doc/qt5/qtquick/images/declarative-pathcurve.png
  8439. share/doc/qt5/qtquick/images/declarative-pathquad.png
  8440. share/doc/qt5/qtquick/images/declarative-pathsvg.png
  8441. share/doc/qt5/qtquick/images/declarative-percent.png
  8442. share/doc/qt5/qtquick/images/declarative-qmlfocus1.png
  8443. share/doc/qt5/qtquick/images/declarative-qmlfocus2.png
  8444. share/doc/qt5/qtquick/images/declarative-qmlfocus3.png
  8445. share/doc/qt5/qtquick/images/declarative-qmlfocus4.png
  8446. share/doc/qt5/qtquick/images/declarative-qmlfocus5.png
  8447. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
  8448. share/doc/qt5/qtquick/images/declarative-qtlogo-preserveaspectfit.png
  8449. share/doc/qt5/qtquick/images/declarative-qtlogo-stretch.png
  8450. share/doc/qt5/qtquick/images/declarative-qtlogo-tile.png
  8451. share/doc/qt5/qtquick/images/declarative-qtlogo-tilehorizontally.png
  8452. share/doc/qt5/qtquick/images/declarative-qtlogo-tilevertically.png
  8453. share/doc/qt5/qtquick/images/declarative-qtlogo.png
  8454. share/doc/qt5/qtquick/images/declarative-rect.png
  8455. share/doc/qt5/qtquick/images/declarative-rect_gradient.png
  8456. share/doc/qt5/qtquick/images/declarative-rotation.png
  8457. share/doc/qt5/qtquick/images/declarative-samegame.png
  8458. share/doc/qt5/qtquick/images/declarative-scale.png
  8459. share/doc/qt5/qtquick/images/declarative-scalegrid.png
  8460. share/doc/qt5/qtquick/images/declarative-shadereffectitem.png
  8461. share/doc/qt5/qtquick/images/declarative-shadereffectsource.png
  8462. share/doc/qt5/qtquick/images/declarative-text.png
  8463. share/doc/qt5/qtquick/images/declarative-textballoons_example.png
  8464. share/doc/qt5/qtquick/images/declarative-textedit.gif
  8465. share/doc/qt5/qtquick/images/declarative-textformat.png
  8466. share/doc/qt5/qtquick/images/declarative-textstyle.png
  8467. share/doc/qt5/qtquick/images/declarative-transformorigin.png
  8468. share/doc/qt5/qtquick/images/declarative-tutorial1.png
  8469. share/doc/qt5/qtquick/images/declarative-tutorial2.png
  8470. share/doc/qt5/qtquick/images/declarative-tutorial3_animation.gif
  8471. share/doc/qt5/qtquick/images/edge1.png
  8472. share/doc/qt5/qtquick/images/edge2.png
  8473. share/doc/qt5/qtquick/images/edge3.png
  8474. share/doc/qt5/qtquick/images/edge4.png
  8475. share/doc/qt5/qtquick/images/edges_qml.png
  8476. share/doc/qt5/qtquick/images/flickable-contentXY-bottom-left.png
  8477. share/doc/qt5/qtquick/images/flickable-contentXY-bottom-right.png
  8478. share/doc/qt5/qtquick/images/flickable-contentXY-resting.png
  8479. share/doc/qt5/qtquick/images/flickable-contentXY-top-left.png
  8480. share/doc/qt5/qtquick/images/flickable-contentXY-top-right.png
  8481. share/doc/qt5/qtquick/images/flickable-rebound.gif
  8482. share/doc/qt5/qtquick/images/flickable.gif
  8483. share/doc/qt5/qtquick/images/flipable.gif
  8484. share/doc/qt5/qtquick/images/fuzzydot.png
  8485. share/doc/qt5/qtquick/images/gameoflife.png
  8486. share/doc/qt5/qtquick/images/glowdot.png
  8487. share/doc/qt5/qtquick/images/graph-example.jpg
  8488. share/doc/qt5/qtquick/images/gridLayout_aligncenter.png
  8489. share/doc/qt5/qtquick/images/gridLayout_aligntop.png
  8490. share/doc/qt5/qtquick/images/gridLayout_aligntopleft.png
  8491. share/doc/qt5/qtquick/images/gridLayout_example.png
  8492. share/doc/qt5/qtquick/images/gridlayout.png
  8493. share/doc/qt5/qtquick/images/gridview-highlight.png
  8494. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
  8495. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
  8496. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
  8497. share/doc/qt5/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
  8498. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
  8499. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
  8500. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
  8501. share/doc/qt5/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
  8502. share/doc/qt5/qtquick/images/gridview-simple.png
  8503. share/doc/qt5/qtquick/images/home.png
  8504. share/doc/qt5/qtquick/images/horizontalpositioner_example.png
  8505. share/doc/qt5/qtquick/images/ico_note.png
  8506. share/doc/qt5/qtquick/images/ico_note_attention.png
  8507. share/doc/qt5/qtquick/images/ico_out.png
  8508. share/doc/qt5/qtquick/images/imageprovider.png
  8509. share/doc/qt5/qtquick/images/layoutmirroring.png
  8510. share/doc/qt5/qtquick/images/listview-decorations.png
  8511. share/doc/qt5/qtquick/images/listview-highlight.png
  8512. share/doc/qt5/qtquick/images/listview-layout-bottomtotop.png
  8513. share/doc/qt5/qtquick/images/listview-layout-lefttoright.png
  8514. share/doc/qt5/qtquick/images/listview-layout-righttoleft.png
  8515. share/doc/qt5/qtquick/images/listview-layout-toptobottom.png
  8516. share/doc/qt5/qtquick/images/listview-section.png
  8517. share/doc/qt5/qtquick/images/listview-setup.png
  8518. share/doc/qt5/qtquick/images/listview-simple.png
  8519. share/doc/qt5/qtquick/images/logo.png
  8520. share/doc/qt5/qtquick/images/manual-layout.png
  8521. share/doc/qt5/qtquick/images/margins_qml.png
  8522. share/doc/qt5/qtquick/images/modelview-overview.png
  8523. share/doc/qt5/qtquick/images/openglunderqml-example.jpg
  8524. share/doc/qt5/qtquick/images/parentchange.png
  8525. share/doc/qt5/qtquick/images/pathitem-code-example.png
  8526. share/doc/qt5/qtquick/images/pathview.gif
  8527. share/doc/qt5/qtquick/images/pointerHandlerMargin.png
  8528. share/doc/qt5/qtquick/images/positioner-example.png
  8529. share/doc/qt5/qtquick/images/qeasingcurve-inback.png
  8530. share/doc/qt5/qtquick/images/qeasingcurve-inbounce.png
  8531. share/doc/qt5/qtquick/images/qeasingcurve-incirc.png
  8532. share/doc/qt5/qtquick/images/qeasingcurve-incubic.png
  8533. share/doc/qt5/qtquick/images/qeasingcurve-inelastic.png
  8534. share/doc/qt5/qtquick/images/qeasingcurve-inexpo.png
  8535. share/doc/qt5/qtquick/images/qeasingcurve-inoutback.png
  8536. share/doc/qt5/qtquick/images/qeasingcurve-inoutbounce.png
  8537. share/doc/qt5/qtquick/images/qeasingcurve-inoutcirc.png
  8538. share/doc/qt5/qtquick/images/qeasingcurve-inoutcubic.png
  8539. share/doc/qt5/qtquick/images/qeasingcurve-inoutelastic.png
  8540. share/doc/qt5/qtquick/images/qeasingcurve-inoutexpo.png
  8541. share/doc/qt5/qtquick/images/qeasingcurve-inoutquad.png
  8542. share/doc/qt5/qtquick/images/qeasingcurve-inoutquart.png
  8543. share/doc/qt5/qtquick/images/qeasingcurve-inoutquint.png
  8544. share/doc/qt5/qtquick/images/qeasingcurve-inoutsine.png
  8545. share/doc/qt5/qtquick/images/qeasingcurve-inquad.png
  8546. share/doc/qt5/qtquick/images/qeasingcurve-inquart.png
  8547. share/doc/qt5/qtquick/images/qeasingcurve-inquint.png
  8548. share/doc/qt5/qtquick/images/qeasingcurve-insine.png
  8549. share/doc/qt5/qtquick/images/qeasingcurve-linear.png
  8550. share/doc/qt5/qtquick/images/qeasingcurve-outback.png
  8551. share/doc/qt5/qtquick/images/qeasingcurve-outbounce.png
  8552. share/doc/qt5/qtquick/images/qeasingcurve-outcirc.png
  8553. share/doc/qt5/qtquick/images/qeasingcurve-outcubic.png
  8554. share/doc/qt5/qtquick/images/qeasingcurve-outelastic.png
  8555. share/doc/qt5/qtquick/images/qeasingcurve-outexpo.png
  8556. share/doc/qt5/qtquick/images/qeasingcurve-outinback.png
  8557. share/doc/qt5/qtquick/images/qeasingcurve-outinbounce.png
  8558. share/doc/qt5/qtquick/images/qeasingcurve-outincirc.png
  8559. share/doc/qt5/qtquick/images/qeasingcurve-outincubic.png
  8560. share/doc/qt5/qtquick/images/qeasingcurve-outinelastic.png
  8561. share/doc/qt5/qtquick/images/qeasingcurve-outinexpo.png
  8562. share/doc/qt5/qtquick/images/qeasingcurve-outinquad.png
  8563. share/doc/qt5/qtquick/images/qeasingcurve-outinquart.png
  8564. share/doc/qt5/qtquick/images/qeasingcurve-outinquint.png
  8565. share/doc/qt5/qtquick/images/qeasingcurve-outinsine.png
  8566. share/doc/qt5/qtquick/images/qeasingcurve-outquad.png
  8567. share/doc/qt5/qtquick/images/qeasingcurve-outquart.png
  8568. share/doc/qt5/qtquick/images/qeasingcurve-outquint.png
  8569. share/doc/qt5/qtquick/images/qeasingcurve-outsine.png
  8570. share/doc/qt5/qtquick/images/qml-abstractitemmodel-example.png
  8571. share/doc/qt5/qtquick/images/qml-affectors-example.png
  8572. share/doc/qt5/qtquick/images/qml-animations-example.png
  8573. share/doc/qt5/qtquick/images/qml-blending-layered.png
  8574. share/doc/qt5/qtquick/images/qml-blending-nonlayered.png
  8575. share/doc/qt5/qtquick/images/qml-borderimage-normal-image.png
  8576. share/doc/qt5/qtquick/images/qml-borderimage-scaled.png
  8577. share/doc/qt5/qtquick/images/qml-borderimage-tiled.png
  8578. share/doc/qt5/qtquick/images/qml-canvas-example.png
  8579. share/doc/qt5/qtquick/images/qml-column.png
  8580. share/doc/qt5/qtquick/images/qml-customparticle-example.png
  8581. share/doc/qt5/qtquick/images/qml-dialcontrol-example.png
  8582. share/doc/qt5/qtquick/images/qml-dnd2-example.png
  8583. share/doc/qt5/qtquick/images/qml-draganddrop-example.png
  8584. share/doc/qt5/qtquick/images/qml-emitters-example.png
  8585. share/doc/qt5/qtquick/images/qml-flipable-example.png
  8586. share/doc/qt5/qtquick/images/qml-flow-snippet.png
  8587. share/doc/qt5/qtquick/images/qml-flow-text1.png
  8588. share/doc/qt5/qtquick/images/qml-flow-text2.png
  8589. share/doc/qt5/qtquick/images/qml-gradient.png
  8590. share/doc/qt5/qtquick/images/qml-grid-no-spacing.png
  8591. share/doc/qt5/qtquick/images/qml-grid-spacing.png
  8592. share/doc/qt5/qtquick/images/qml-imageelements-example.png
  8593. share/doc/qt5/qtquick/images/qml-imageparticle-example.png
  8594. share/doc/qt5/qtquick/images/qml-imageprovider-example.png
  8595. share/doc/qt5/qtquick/images/qml-item-canvas-arc.png
  8596. share/doc/qt5/qtquick/images/qml-item-canvas-arcTo.png
  8597. share/doc/qt5/qtquick/images/qml-item-canvas-bezierCurveTo.png
  8598. share/doc/qt5/qtquick/images/qml-item-canvas-clip-complex.png
  8599. share/doc/qt5/qtquick/images/qml-item-canvas-context.gif
  8600. share/doc/qt5/qtquick/images/qml-item-canvas-lineDash.png
  8601. share/doc/qt5/qtquick/images/qml-item-canvas-math-rotate.png
  8602. share/doc/qt5/qtquick/images/qml-item-canvas-math.png
  8603. share/doc/qt5/qtquick/images/qml-item-canvas-rotate.png
  8604. share/doc/qt5/qtquick/images/qml-item-canvas-scale.png
  8605. share/doc/qt5/qtquick/images/qml-item-canvas-scalex.png
  8606. share/doc/qt5/qtquick/images/qml-item-canvas-scaley.png
  8607. share/doc/qt5/qtquick/images/qml-item-canvas-skewx.png
  8608. share/doc/qt5/qtquick/images/qml-item-canvas-skewy.png
  8609. share/doc/qt5/qtquick/images/qml-item-canvas-startAngle.png
  8610. share/doc/qt5/qtquick/images/qml-item-canvas-translate.png
  8611. share/doc/qt5/qtquick/images/qml-item-canvas-translatey.png
  8612. share/doc/qt5/qtquick/images/qml-keyinteraction-example.png
  8613. share/doc/qt5/qtquick/images/qml-listview-sections-example.png
  8614. share/doc/qt5/qtquick/images/qml-localstorage-example.png
  8615. share/doc/qt5/qtquick/images/qml-modelviews-example.png
  8616. share/doc/qt5/qtquick/images/qml-mousearea-example.png
  8617. share/doc/qt5/qtquick/images/qml-mousearea-snippet.png
  8618. share/doc/qt5/qtquick/images/qml-objectlistmodel-example.png
  8619. share/doc/qt5/qtquick/images/qml-positioners-example.png
  8620. share/doc/qt5/qtquick/images/qml-righttoleft-example.png
  8621. share/doc/qt5/qtquick/images/qml-row.png
  8622. share/doc/qt5/qtquick/images/qml-scrollbar-example.png
  8623. share/doc/qt5/qtquick/images/qml-shadereffect-layereffect.png
  8624. share/doc/qt5/qtquick/images/qml-shadereffect-nolayereffect.png
  8625. share/doc/qt5/qtquick/images/qml-shadereffect-opacitymask.png
  8626. share/doc/qt5/qtquick/images/qml-shadereffects-example.png
  8627. share/doc/qt5/qtquick/images/qml-shapes-example.png
  8628. share/doc/qt5/qtquick/images/qml-stringlistmodel-example.png
  8629. share/doc/qt5/qtquick/images/qml-system-example.png
  8630. share/doc/qt5/qtquick/images/qml-tabwidget-example.png
  8631. share/doc/qt5/qtquick/images/qml-text-example.png
  8632. share/doc/qt5/qtquick/images/qml-threading-example.png
  8633. share/doc/qt5/qtquick/images/qml-touchinteraction-example.png
  8634. share/doc/qt5/qtquick/images/qml-window-example.png
  8635. share/doc/qt5/qtquick/images/qt-pixelator.png
  8636. share/doc/qt5/qtquick/images/qtlabs-wavefrontmesh.png
  8637. share/doc/qt5/qtquick/images/qtquickcontrols2-gallery-welcome.png
  8638. share/doc/qt5/qtquick/images/qtquicklayouts-example-layouts.png
  8639. share/doc/qt5/qtquick/images/qtquickwidgets-example.png
  8640. share/doc/qt5/qtquick/images/rect-color.png
  8641. share/doc/qt5/qtquick/images/rendercontrol-example.jpg
  8642. share/doc/qt5/qtquick/images/repeater-index.png
  8643. share/doc/qt5/qtquick/images/repeater-modeldata.png
  8644. share/doc/qt5/qtquick/images/repeater-simple.png
  8645. share/doc/qt5/qtquick/images/repeater.png
  8646. share/doc/qt5/qtquick/images/rowlayout-minimum.png
  8647. share/doc/qt5/qtquick/images/rowlayout.png
  8648. share/doc/qt5/qtquick/images/screen-and-window-dimensions.jpg
  8649. share/doc/qt5/qtquick/images/sg-renderloop-singlethreaded.jpg
  8650. share/doc/qt5/qtquick/images/sg-renderloop-threaded.jpg
  8651. share/doc/qt5/qtquick/images/shape-radial-gradient.png
  8652. share/doc/qt5/qtquick/images/simplematerial-example.jpg
  8653. share/doc/qt5/qtquick/images/spritecutting.png
  8654. share/doc/qt5/qtquick/images/spriteenginegraph.png
  8655. share/doc/qt5/qtquick/images/star.png
  8656. share/doc/qt5/qtquick/images/textureinsgnode-example.jpg
  8657. share/doc/qt5/qtquick/images/textureinthread-example.jpg
  8658. share/doc/qt5/qtquick/images/touchpoint-metrics.png
  8659. share/doc/qt5/qtquick/images/touchpoints-pinchhandler.png
  8660. share/doc/qt5/qtquick/images/translate.png
  8661. share/doc/qt5/qtquick/images/twotextureproviders-example.jpg
  8662. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/face-smile.png
  8663. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/moon.png
  8664. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/shadow.png
  8665. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/star.png
  8666. share/doc/qt5/qtquick/images/used-in-examples/animation/basics/images/sun.png
  8667. share/doc/qt5/qtquick/images/used-in-examples/animation/states/qt-logo.png
  8668. share/doc/qt5/qtquick/images/used-in-examples/canvas/contents/qt-logo.png
  8669. share/doc/qt5/qtquick/images/used-in-examples/canvas/squircle/squircle.png
  8670. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/background.png
  8671. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle.png
  8672. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/needle_shadow.png
  8673. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/overlay.png
  8674. share/doc/qt5/qtquick/images/used-in-examples/customitems/dialcontrol/content/quit.png
  8675. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/5_heart.png
  8676. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/9_club.png
  8677. share/doc/qt5/qtquick/images/used-in-examples/customitems/flipable/content/back.png
  8678. share/doc/qt5/qtquick/images/used-in-examples/customitems/scrollbar/pics/niagara_falls.jpg
  8679. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/BearSheet.png
  8680. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/Uniflow_steam_engine.gif
  8681. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/arrow.png
  8682. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/bw.png
  8683. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/colors.png
  8684. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/qt-logo.png
  8685. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/shadow.png
  8686. share/doc/qt5/qtquick/images/used-in-examples/imageelements/content/speaker.png
  8687. share/doc/qt5/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/arrow.png
  8688. share/doc/qt5/qtquick/images/used-in-examples/keyinteraction/focus/Core/images/qt-logo.png
  8689. share/doc/qt5/qtquick/images/used-in-examples/shadereffects/content/face-smile.png
  8690. share/doc/qt5/qtquick/images/used-in-examples/shadereffects/content/qt-logo.png
  8691. share/doc/qt5/qtquick/images/used-in-examples/tableview/pixelator/qt.png
  8692. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-sad.png
  8693. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-smile-big.png
  8694. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/face-smile.png
  8695. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/heart200.png
  8696. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/qtlogo.png
  8697. share/doc/qt5/qtquick/images/used-in-examples/text/imgtag/images/starfish_2.png
  8698. share/doc/qt5/qtquick/images/used-in-examples/text/textselection/pics/endHandle.png
  8699. share/doc/qt5/qtquick/images/used-in-examples/text/textselection/pics/startHandle.png
  8700. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/cork.jpg
  8701. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/note-yellow.png
  8702. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/flickable/content/tack.png
  8703. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear0.png
  8704. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear1.png
  8705. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear2.png
  8706. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/Bear3.png
  8707. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/BearB.png
  8708. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle.png
  8709. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/blur-circle3.png
  8710. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/heart-blur.png
  8711. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/multipointtouch/content/title.png
  8712. share/doc/qt5/qtquick/images/used-in-examples/touchinteraction/pincharea/qt-logo.jpg
  8713. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/AddressBook_48.png
  8714. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/AudioPlayer_48.png
  8715. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/Camera_48.png
  8716. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/DateBook_48.png
  8717. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/EMail_48.png
  8718. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/TodoList_48.png
  8719. share/doc/qt5/qtquick/images/used-in-examples/views/gridview/pics/VideoPlayer_48.png
  8720. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/arrow-down.png
  8721. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/arrow-up.png
  8722. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/fruit-salad.jpg
  8723. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/hamburger.jpg
  8724. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/lemonade.jpg
  8725. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/list-delete.png
  8726. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/minus-sign.png
  8727. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/moreDown.png
  8728. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/moreUp.png
  8729. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/pancakes.jpg
  8730. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/plus-sign.png
  8731. share/doc/qt5/qtquick/images/used-in-examples/views/listview/content/pics/vegetable-soup.jpg
  8732. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/AddressBook_48.png
  8733. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/AudioPlayer_48.png
  8734. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/Camera_48.png
  8735. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/DateBook_48.png
  8736. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/EMail_48.png
  8737. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/TodoList_48.png
  8738. share/doc/qt5/qtquick/images/used-in-examples/views/pathview/pics/VideoPlayer_48.png
  8739. share/doc/qt5/qtquick/images/used-in-examples/window/resources/icon64.png
  8740. share/doc/qt5/qtquick/images/verticalpositioner_example.png
  8741. share/doc/qt5/qtquick/images/verticalpositioner_transition.gif
  8742. share/doc/qt5/qtquick/images/viewtransitions-basic.gif
  8743. share/doc/qt5/qtquick/images/viewtransitions-delayedbyindex.gif
  8744. share/doc/qt5/qtquick/images/viewtransitions-intermediatemove.gif
  8745. share/doc/qt5/qtquick/images/viewtransitions-interruptedbad.gif
  8746. share/doc/qt5/qtquick/images/viewtransitions-interruptedgood.gif
  8747. share/doc/qt5/qtquick/images/viewtransitions-pathanim.gif
  8748. share/doc/qt5/qtquick/images/viewtransitions-scriptactionbad.gif
  8749. share/doc/qt5/qtquick/images/visual-coordinates-example.png
  8750. share/doc/qt5/qtquick/images/visual-parent-example.png
  8751. share/doc/qt5/qtquick/images/visual-parent-example2.png
  8752. share/doc/qt5/qtquick/images/visualcanvas_list.png
  8753. share/doc/qt5/qtquick/images/visualcanvas_overlap.png
  8754. share/doc/qt5/qtquick/images/visualize-batches.png
  8755. share/doc/qt5/qtquick/images/visualize-clip.png
  8756. share/doc/qt5/qtquick/images/visualize-original.png
  8757. share/doc/qt5/qtquick/images/visualize-overdraw-1.png
  8758. share/doc/qt5/qtquick/images/visualize-overdraw-2.png
  8759. share/doc/qt5/qtquick/images/visualpath-code-example.png
  8760. share/doc/qt5/qtquick/qml-advtutorial.html
  8761. share/doc/qt5/qtquick/qml-color.html
  8762. share/doc/qt5/qtquick/qml-dynamicview-tutorial.html
  8763. share/doc/qt5/qtquick/qml-font.html
  8764. share/doc/qt5/qtquick/qml-matrix4x4.html
  8765. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
  8766. share/doc/qt5/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
  8767. share/doc/qt5/qtquick/qml-qt-labs-settings-settings-members.html
  8768. share/doc/qt5/qtquick/qml-qt-labs-settings-settings.html
  8769. share/doc/qt5/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh-members.html
  8770. share/doc/qt5/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh.html
  8771. share/doc/qt5/qtquick/qml-qtquick-accessible-members.html
  8772. share/doc/qt5/qtquick/qml-qtquick-accessible.html
  8773. share/doc/qt5/qtquick/qml-qtquick-anchoranimation-members.html
  8774. share/doc/qt5/qtquick/qml-qtquick-anchoranimation.html
  8775. share/doc/qt5/qtquick/qml-qtquick-anchorchanges-members.html
  8776. share/doc/qt5/qtquick/qml-qtquick-anchorchanges.html
  8777. share/doc/qt5/qtquick/qml-qtquick-animatedimage-members.html
  8778. share/doc/qt5/qtquick/qml-qtquick-animatedimage.html
  8779. share/doc/qt5/qtquick/qml-qtquick-animatedsprite-members.html
  8780. share/doc/qt5/qtquick/qml-qtquick-animatedsprite.html
  8781. share/doc/qt5/qtquick/qml-qtquick-animation-members.html
  8782. share/doc/qt5/qtquick/qml-qtquick-animation.html
  8783. share/doc/qt5/qtquick/qml-qtquick-animationcontroller-members.html
  8784. share/doc/qt5/qtquick/qml-qtquick-animationcontroller.html
  8785. share/doc/qt5/qtquick/qml-qtquick-animator-members.html
  8786. share/doc/qt5/qtquick/qml-qtquick-animator.html
  8787. share/doc/qt5/qtquick/qml-qtquick-behavior-members.html
  8788. share/doc/qt5/qtquick/qml-qtquick-behavior.html
  8789. share/doc/qt5/qtquick/qml-qtquick-borderimage-members.html
  8790. share/doc/qt5/qtquick/qml-qtquick-borderimage.html
  8791. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh-members.html
  8792. share/doc/qt5/qtquick/qml-qtquick-borderimagemesh.html
  8793. share/doc/qt5/qtquick/qml-qtquick-canvas-members.html
  8794. share/doc/qt5/qtquick/qml-qtquick-canvas-obsolete.html
  8795. share/doc/qt5/qtquick/qml-qtquick-canvas.html
  8796. share/doc/qt5/qtquick/qml-qtquick-canvasgradient-members.html
  8797. share/doc/qt5/qtquick/qml-qtquick-canvasgradient.html
  8798. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata-members.html
  8799. share/doc/qt5/qtquick/qml-qtquick-canvasimagedata.html
  8800. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray-members.html
  8801. share/doc/qt5/qtquick/qml-qtquick-canvaspixelarray.html
  8802. share/doc/qt5/qtquick/qml-qtquick-coloranimation-members.html
  8803. share/doc/qt5/qtquick/qml-qtquick-coloranimation.html
  8804. share/doc/qt5/qtquick/qml-qtquick-column-members.html
  8805. share/doc/qt5/qtquick/qml-qtquick-column.html
  8806. share/doc/qt5/qtquick/qml-qtquick-context2d-members.html
  8807. share/doc/qt5/qtquick/qml-qtquick-context2d.html
  8808. share/doc/qt5/qtquick/qml-qtquick-doublevalidator-members.html
  8809. share/doc/qt5/qtquick/qml-qtquick-doublevalidator.html
  8810. share/doc/qt5/qtquick/qml-qtquick-drag-members.html
  8811. share/doc/qt5/qtquick/qml-qtquick-drag.html
  8812. share/doc/qt5/qtquick/qml-qtquick-dragevent-members.html
  8813. share/doc/qt5/qtquick/qml-qtquick-dragevent.html
  8814. share/doc/qt5/qtquick/qml-qtquick-draghandler-members.html
  8815. share/doc/qt5/qtquick/qml-qtquick-draghandler.html
  8816. share/doc/qt5/qtquick/qml-qtquick-droparea-members.html
  8817. share/doc/qt5/qtquick/qml-qtquick-droparea.html
  8818. share/doc/qt5/qtquick/qml-qtquick-enterkey-members.html
  8819. share/doc/qt5/qtquick/qml-qtquick-enterkey.html
  8820. share/doc/qt5/qtquick/qml-qtquick-eventpoint-members.html
  8821. share/doc/qt5/qtquick/qml-qtquick-eventpoint.html
  8822. share/doc/qt5/qtquick/qml-qtquick-eventtouchpoint-members.html
  8823. share/doc/qt5/qtquick/qml-qtquick-eventtouchpoint.html
  8824. share/doc/qt5/qtquick/qml-qtquick-flickable-members.html
  8825. share/doc/qt5/qtquick/qml-qtquick-flickable.html
  8826. share/doc/qt5/qtquick/qml-qtquick-flipable-members.html
  8827. share/doc/qt5/qtquick/qml-qtquick-flipable.html
  8828. share/doc/qt5/qtquick/qml-qtquick-flow-members.html
  8829. share/doc/qt5/qtquick/qml-qtquick-flow.html
  8830. share/doc/qt5/qtquick/qml-qtquick-focusscope-members.html
  8831. share/doc/qt5/qtquick/qml-qtquick-focusscope.html
  8832. share/doc/qt5/qtquick/qml-qtquick-fontloader-members.html
  8833. share/doc/qt5/qtquick/qml-qtquick-fontloader.html
  8834. share/doc/qt5/qtquick/qml-qtquick-fontmetrics-members.html
  8835. share/doc/qt5/qtquick/qml-qtquick-fontmetrics.html
  8836. share/doc/qt5/qtquick/qml-qtquick-gestureevent-members.html
  8837. share/doc/qt5/qtquick/qml-qtquick-gestureevent.html
  8838. share/doc/qt5/qtquick/qml-qtquick-gradient-members.html
  8839. share/doc/qt5/qtquick/qml-qtquick-gradient.html
  8840. share/doc/qt5/qtquick/qml-qtquick-gradientstop-members.html
  8841. share/doc/qt5/qtquick/qml-qtquick-gradientstop.html
  8842. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo-members.html
  8843. share/doc/qt5/qtquick/qml-qtquick-graphicsinfo.html
  8844. share/doc/qt5/qtquick/qml-qtquick-grid-members.html
  8845. share/doc/qt5/qtquick/qml-qtquick-grid.html
  8846. share/doc/qt5/qtquick/qml-qtquick-gridmesh-members.html
  8847. share/doc/qt5/qtquick/qml-qtquick-gridmesh.html
  8848. share/doc/qt5/qtquick/qml-qtquick-gridview-members.html
  8849. share/doc/qt5/qtquick/qml-qtquick-gridview.html
  8850. share/doc/qt5/qtquick/qml-qtquick-handlerpoint-members.html
  8851. share/doc/qt5/qtquick/qml-qtquick-handlerpoint.html
  8852. share/doc/qt5/qtquick/qml-qtquick-hoverhandler-members.html
  8853. share/doc/qt5/qtquick/qml-qtquick-hoverhandler.html
  8854. share/doc/qt5/qtquick/qml-qtquick-image-members.html
  8855. share/doc/qt5/qtquick/qml-qtquick-image.html
  8856. share/doc/qt5/qtquick/qml-qtquick-intvalidator-members.html
  8857. share/doc/qt5/qtquick/qml-qtquick-intvalidator.html
  8858. share/doc/qt5/qtquick/qml-qtquick-item-members.html
  8859. share/doc/qt5/qtquick/qml-qtquick-item.html
  8860. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult-members.html
  8861. share/doc/qt5/qtquick/qml-qtquick-itemgrabresult.html
  8862. share/doc/qt5/qtquick/qml-qtquick-keyevent-members.html
  8863. share/doc/qt5/qtquick/qml-qtquick-keyevent.html
  8864. share/doc/qt5/qtquick/qml-qtquick-keynavigation-members.html
  8865. share/doc/qt5/qtquick/qml-qtquick-keynavigation.html
  8866. share/doc/qt5/qtquick/qml-qtquick-keys-members.html
  8867. share/doc/qt5/qtquick/qml-qtquick-keys.html
  8868. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring-members.html
  8869. share/doc/qt5/qtquick/qml-qtquick-layoutmirroring.html
  8870. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout-members.html
  8871. share/doc/qt5/qtquick/qml-qtquick-layouts-columnlayout.html
  8872. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout-members.html
  8873. share/doc/qt5/qtquick/qml-qtquick-layouts-gridlayout.html
  8874. share/doc/qt5/qtquick/qml-qtquick-layouts-layout-members.html
  8875. share/doc/qt5/qtquick/qml-qtquick-layouts-layout.html
  8876. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout-members.html
  8877. share/doc/qt5/qtquick/qml-qtquick-layouts-rowlayout.html
  8878. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout-members.html
  8879. share/doc/qt5/qtquick/qml-qtquick-layouts-stacklayout.html
  8880. share/doc/qt5/qtquick/qml-qtquick-listview-members.html
  8881. share/doc/qt5/qtquick/qml-qtquick-listview.html
  8882. share/doc/qt5/qtquick/qml-qtquick-loader-members.html
  8883. share/doc/qt5/qtquick/qml-qtquick-loader.html
  8884. share/doc/qt5/qtquick/qml-qtquick-matrix4x4-members.html
  8885. share/doc/qt5/qtquick/qml-qtquick-matrix4x4.html
  8886. share/doc/qt5/qtquick/qml-qtquick-mousearea-members.html
  8887. share/doc/qt5/qtquick/qml-qtquick-mousearea.html
  8888. share/doc/qt5/qtquick/qml-qtquick-mouseevent-members.html
  8889. share/doc/qt5/qtquick/qml-qtquick-mouseevent.html
  8890. share/doc/qt5/qtquick/qml-qtquick-multipointhandler-members.html
  8891. share/doc/qt5/qtquick/qml-qtquick-multipointhandler.html
  8892. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea-members.html
  8893. share/doc/qt5/qtquick/qml-qtquick-multipointtoucharea.html
  8894. share/doc/qt5/qtquick/qml-qtquick-numberanimation-members.html
  8895. share/doc/qt5/qtquick/qml-qtquick-numberanimation.html
  8896. share/doc/qt5/qtquick/qml-qtquick-opacityanimator-members.html
  8897. share/doc/qt5/qtquick/qml-qtquick-opacityanimator.html
  8898. share/doc/qt5/qtquick/qml-qtquick-openglinfo-members.html
  8899. share/doc/qt5/qtquick/qml-qtquick-openglinfo.html
  8900. share/doc/qt5/qtquick/qml-qtquick-parallelanimation-members.html
  8901. share/doc/qt5/qtquick/qml-qtquick-parallelanimation.html
  8902. share/doc/qt5/qtquick/qml-qtquick-parentanimation-members.html
  8903. share/doc/qt5/qtquick/qml-qtquick-parentanimation.html
  8904. share/doc/qt5/qtquick/qml-qtquick-parentchange-members.html
  8905. share/doc/qt5/qtquick/qml-qtquick-parentchange.html
  8906. share/doc/qt5/qtquick/qml-qtquick-particles-affector-members.html
  8907. share/doc/qt5/qtquick/qml-qtquick-particles-affector.html
  8908. share/doc/qt5/qtquick/qml-qtquick-particles-age-members.html
  8909. share/doc/qt5/qtquick/qml-qtquick-particles-age.html
  8910. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection-members.html
  8911. share/doc/qt5/qtquick/qml-qtquick-particles-angledirection.html
  8912. share/doc/qt5/qtquick/qml-qtquick-particles-attractor-members.html
  8913. share/doc/qt5/qtquick/qml-qtquick-particles-attractor.html
  8914. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection-members.html
  8915. share/doc/qt5/qtquick/qml-qtquick-particles-cumulativedirection.html
  8916. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle-members.html
  8917. share/doc/qt5/qtquick/qml-qtquick-particles-customparticle.html
  8918. share/doc/qt5/qtquick/qml-qtquick-particles-direction-members.html
  8919. share/doc/qt5/qtquick/qml-qtquick-particles-direction.html
  8920. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape-members.html
  8921. share/doc/qt5/qtquick/qml-qtquick-particles-ellipseshape.html
  8922. share/doc/qt5/qtquick/qml-qtquick-particles-emitter-members.html
  8923. share/doc/qt5/qtquick/qml-qtquick-particles-emitter.html
  8924. share/doc/qt5/qtquick/qml-qtquick-particles-friction-members.html
  8925. share/doc/qt5/qtquick/qml-qtquick-particles-friction.html
  8926. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-members.html
  8927. share/doc/qt5/qtquick/qml-qtquick-particles-gravity-obsolete.html
  8928. share/doc/qt5/qtquick/qml-qtquick-particles-gravity.html
  8929. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal-members.html
  8930. share/doc/qt5/qtquick/qml-qtquick-particles-groupgoal.html
  8931. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle-members.html
  8932. share/doc/qt5/qtquick/qml-qtquick-particles-imageparticle.html
  8933. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle-members.html
  8934. share/doc/qt5/qtquick/qml-qtquick-particles-itemparticle.html
  8935. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape-members.html
  8936. share/doc/qt5/qtquick/qml-qtquick-particles-lineshape.html
  8937. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape-members.html
  8938. share/doc/qt5/qtquick/qml-qtquick-particles-maskshape.html
  8939. share/doc/qt5/qtquick/qml-qtquick-particles-particle-members.html
  8940. share/doc/qt5/qtquick/qml-qtquick-particles-particle.html
  8941. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup-members.html
  8942. share/doc/qt5/qtquick/qml-qtquick-particles-particlegroup.html
  8943. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter-members.html
  8944. share/doc/qt5/qtquick/qml-qtquick-particles-particlepainter.html
  8945. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem-members.html
  8946. share/doc/qt5/qtquick/qml-qtquick-particles-particlesystem.html
  8947. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection-members.html
  8948. share/doc/qt5/qtquick/qml-qtquick-particles-pointdirection.html
  8949. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape-members.html
  8950. share/doc/qt5/qtquick/qml-qtquick-particles-rectangleshape.html
  8951. share/doc/qt5/qtquick/qml-qtquick-particles-shape-members.html
  8952. share/doc/qt5/qtquick/qml-qtquick-particles-shape.html
  8953. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal-members.html
  8954. share/doc/qt5/qtquick/qml-qtquick-particles-spritegoal.html
  8955. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection-members.html
  8956. share/doc/qt5/qtquick/qml-qtquick-particles-targetdirection.html
  8957. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter-members.html
  8958. share/doc/qt5/qtquick/qml-qtquick-particles-trailemitter.html
  8959. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence-members.html
  8960. share/doc/qt5/qtquick/qml-qtquick-particles-turbulence.html
  8961. share/doc/qt5/qtquick/qml-qtquick-particles-wander-members.html
  8962. share/doc/qt5/qtquick/qml-qtquick-particles-wander.html
  8963. share/doc/qt5/qtquick/qml-qtquick-path-members.html
  8964. share/doc/qt5/qtquick/qml-qtquick-path.html
  8965. share/doc/qt5/qtquick/qml-qtquick-pathanglearc-members.html
  8966. share/doc/qt5/qtquick/qml-qtquick-pathanglearc.html
  8967. share/doc/qt5/qtquick/qml-qtquick-pathanimation-members.html
  8968. share/doc/qt5/qtquick/qml-qtquick-pathanimation.html
  8969. share/doc/qt5/qtquick/qml-qtquick-patharc-members.html
  8970. share/doc/qt5/qtquick/qml-qtquick-patharc.html
  8971. share/doc/qt5/qtquick/qml-qtquick-pathattribute-members.html
  8972. share/doc/qt5/qtquick/qml-qtquick-pathattribute.html
  8973. share/doc/qt5/qtquick/qml-qtquick-pathcubic-members.html
  8974. share/doc/qt5/qtquick/qml-qtquick-pathcubic.html
  8975. share/doc/qt5/qtquick/qml-qtquick-pathcurve-members.html
  8976. share/doc/qt5/qtquick/qml-qtquick-pathcurve.html
  8977. share/doc/qt5/qtquick/qml-qtquick-pathelement-members.html
  8978. share/doc/qt5/qtquick/qml-qtquick-pathelement.html
  8979. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator-members.html
  8980. share/doc/qt5/qtquick/qml-qtquick-pathinterpolator.html
  8981. share/doc/qt5/qtquick/qml-qtquick-pathline-members.html
  8982. share/doc/qt5/qtquick/qml-qtquick-pathline.html
  8983. share/doc/qt5/qtquick/qml-qtquick-pathmove-members.html
  8984. share/doc/qt5/qtquick/qml-qtquick-pathmove.html
  8985. share/doc/qt5/qtquick/qml-qtquick-pathpercent-members.html
  8986. share/doc/qt5/qtquick/qml-qtquick-pathpercent.html
  8987. share/doc/qt5/qtquick/qml-qtquick-pathquad-members.html
  8988. share/doc/qt5/qtquick/qml-qtquick-pathquad.html
  8989. share/doc/qt5/qtquick/qml-qtquick-pathsvg-members.html
  8990. share/doc/qt5/qtquick/qml-qtquick-pathsvg.html
  8991. share/doc/qt5/qtquick/qml-qtquick-pathview-members.html
  8992. share/doc/qt5/qtquick/qml-qtquick-pathview.html
  8993. share/doc/qt5/qtquick/qml-qtquick-pauseanimation-members.html
  8994. share/doc/qt5/qtquick/qml-qtquick-pauseanimation.html
  8995. share/doc/qt5/qtquick/qml-qtquick-pincharea-members.html
  8996. share/doc/qt5/qtquick/qml-qtquick-pincharea.html
  8997. share/doc/qt5/qtquick/qml-qtquick-pinchevent-members.html
  8998. share/doc/qt5/qtquick/qml-qtquick-pinchevent.html
  8999. share/doc/qt5/qtquick/qml-qtquick-pinchhandler-members.html
  9000. share/doc/qt5/qtquick/qml-qtquick-pinchhandler.html
  9001. share/doc/qt5/qtquick/qml-qtquick-pointerdevice-members.html
  9002. share/doc/qt5/qtquick/qml-qtquick-pointerdevice.html
  9003. share/doc/qt5/qtquick/qml-qtquick-pointerdevicehandler-members.html
  9004. share/doc/qt5/qtquick/qml-qtquick-pointerdevicehandler.html
  9005. share/doc/qt5/qtquick/qml-qtquick-pointerevent-members.html
  9006. share/doc/qt5/qtquick/qml-qtquick-pointerevent.html
  9007. share/doc/qt5/qtquick/qml-qtquick-pointerhandler-members.html
  9008. share/doc/qt5/qtquick/qml-qtquick-pointerhandler.html
  9009. share/doc/qt5/qtquick/qml-qtquick-pointhandler-members.html
  9010. share/doc/qt5/qtquick/qml-qtquick-pointhandler.html
  9011. share/doc/qt5/qtquick/qml-qtquick-positioner-members.html
  9012. share/doc/qt5/qtquick/qml-qtquick-positioner.html
  9013. share/doc/qt5/qtquick/qml-qtquick-propertyaction-members.html
  9014. share/doc/qt5/qtquick/qml-qtquick-propertyaction.html
  9015. share/doc/qt5/qtquick/qml-qtquick-propertyanimation-members.html
  9016. share/doc/qt5/qtquick/qml-qtquick-propertyanimation.html
  9017. share/doc/qt5/qtquick/qml-qtquick-propertychanges-members.html
  9018. share/doc/qt5/qtquick/qml-qtquick-propertychanges.html
  9019. share/doc/qt5/qtquick/qml-qtquick-rectangle-members.html
  9020. share/doc/qt5/qtquick/qml-qtquick-rectangle.html
  9021. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator-members.html
  9022. share/doc/qt5/qtquick/qml-qtquick-regexpvalidator.html
  9023. share/doc/qt5/qtquick/qml-qtquick-repeater-members.html
  9024. share/doc/qt5/qtquick/qml-qtquick-repeater.html
  9025. share/doc/qt5/qtquick/qml-qtquick-rotation-members.html
  9026. share/doc/qt5/qtquick/qml-qtquick-rotation.html
  9027. share/doc/qt5/qtquick/qml-qtquick-rotationanimation-members.html
  9028. share/doc/qt5/qtquick/qml-qtquick-rotationanimation.html
  9029. share/doc/qt5/qtquick/qml-qtquick-rotationanimator-members.html
  9030. share/doc/qt5/qtquick/qml-qtquick-rotationanimator.html
  9031. share/doc/qt5/qtquick/qml-qtquick-row-members.html
  9032. share/doc/qt5/qtquick/qml-qtquick-row.html
  9033. share/doc/qt5/qtquick/qml-qtquick-scale-members.html
  9034. share/doc/qt5/qtquick/qml-qtquick-scale.html
  9035. share/doc/qt5/qtquick/qml-qtquick-scaleanimator-members.html
  9036. share/doc/qt5/qtquick/qml-qtquick-scaleanimator.html
  9037. share/doc/qt5/qtquick/qml-qtquick-scriptaction-members.html
  9038. share/doc/qt5/qtquick/qml-qtquick-scriptaction.html
  9039. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation-members.html
  9040. share/doc/qt5/qtquick/qml-qtquick-sequentialanimation.html
  9041. share/doc/qt5/qtquick/qml-qtquick-shadereffect-members.html
  9042. share/doc/qt5/qtquick/qml-qtquick-shadereffect.html
  9043. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource-members.html
  9044. share/doc/qt5/qtquick/qml-qtquick-shadereffectsource.html
  9045. share/doc/qt5/qtquick/qml-qtquick-shapes-conicalgradient-members.html
  9046. share/doc/qt5/qtquick/qml-qtquick-shapes-conicalgradient.html
  9047. share/doc/qt5/qtquick/qml-qtquick-shapes-lineargradient-members.html
  9048. share/doc/qt5/qtquick/qml-qtquick-shapes-lineargradient.html
  9049. share/doc/qt5/qtquick/qml-qtquick-shapes-radialgradient-members.html
  9050. share/doc/qt5/qtquick/qml-qtquick-shapes-radialgradient.html
  9051. share/doc/qt5/qtquick/qml-qtquick-shapes-shape-members.html
  9052. share/doc/qt5/qtquick/qml-qtquick-shapes-shape.html
  9053. share/doc/qt5/qtquick/qml-qtquick-shapes-shapegradient-members.html
  9054. share/doc/qt5/qtquick/qml-qtquick-shapes-shapegradient.html
  9055. share/doc/qt5/qtquick/qml-qtquick-shapes-shapepath-members.html
  9056. share/doc/qt5/qtquick/qml-qtquick-shapes-shapepath.html
  9057. share/doc/qt5/qtquick/qml-qtquick-shortcut-members.html
  9058. share/doc/qt5/qtquick/qml-qtquick-shortcut.html
  9059. share/doc/qt5/qtquick/qml-qtquick-singlepointhandler-members.html
  9060. share/doc/qt5/qtquick/qml-qtquick-singlepointhandler.html
  9061. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation-members.html
  9062. share/doc/qt5/qtquick/qml-qtquick-smoothedanimation.html
  9063. share/doc/qt5/qtquick/qml-qtquick-springanimation-members.html
  9064. share/doc/qt5/qtquick/qml-qtquick-springanimation.html
  9065. share/doc/qt5/qtquick/qml-qtquick-sprite-members.html
  9066. share/doc/qt5/qtquick/qml-qtquick-sprite.html
  9067. share/doc/qt5/qtquick/qml-qtquick-spritesequence-members.html
  9068. share/doc/qt5/qtquick/qml-qtquick-spritesequence.html
  9069. share/doc/qt5/qtquick/qml-qtquick-state-members.html
  9070. share/doc/qt5/qtquick/qml-qtquick-state.html
  9071. share/doc/qt5/qtquick/qml-qtquick-statechangescript-members.html
  9072. share/doc/qt5/qtquick/qml-qtquick-statechangescript.html
  9073. share/doc/qt5/qtquick/qml-qtquick-stategroup-members.html
  9074. share/doc/qt5/qtquick/qml-qtquick-stategroup.html
  9075. share/doc/qt5/qtquick/qml-qtquick-systempalette-members.html
  9076. share/doc/qt5/qtquick/qml-qtquick-systempalette.html
  9077. share/doc/qt5/qtquick/qml-qtquick-tableview-members.html
  9078. share/doc/qt5/qtquick/qml-qtquick-tableview.html
  9079. share/doc/qt5/qtquick/qml-qtquick-taphandler-members.html
  9080. share/doc/qt5/qtquick/qml-qtquick-taphandler.html
  9081. share/doc/qt5/qtquick/qml-qtquick-text-members.html
  9082. share/doc/qt5/qtquick/qml-qtquick-text-obsolete.html
  9083. share/doc/qt5/qtquick/qml-qtquick-text.html
  9084. share/doc/qt5/qtquick/qml-qtquick-textedit-members.html
  9085. share/doc/qt5/qtquick/qml-qtquick-textedit.html
  9086. share/doc/qt5/qtquick/qml-qtquick-textinput-members.html
  9087. share/doc/qt5/qtquick/qml-qtquick-textinput.html
  9088. share/doc/qt5/qtquick/qml-qtquick-textmetrics-members.html
  9089. share/doc/qt5/qtquick/qml-qtquick-textmetrics.html
  9090. share/doc/qt5/qtquick/qml-qtquick-touchpoint-members.html
  9091. share/doc/qt5/qtquick/qml-qtquick-touchpoint-obsolete.html
  9092. share/doc/qt5/qtquick/qml-qtquick-touchpoint.html
  9093. share/doc/qt5/qtquick/qml-qtquick-transform-members.html
  9094. share/doc/qt5/qtquick/qml-qtquick-transform.html
  9095. share/doc/qt5/qtquick/qml-qtquick-transition-members.html
  9096. share/doc/qt5/qtquick/qml-qtquick-transition.html
  9097. share/doc/qt5/qtquick/qml-qtquick-translate-members.html
  9098. share/doc/qt5/qtquick/qml-qtquick-translate.html
  9099. share/doc/qt5/qtquick/qml-qtquick-uniformanimator-members.html
  9100. share/doc/qt5/qtquick/qml-qtquick-uniformanimator.html
  9101. share/doc/qt5/qtquick/qml-qtquick-vector3danimation-members.html
  9102. share/doc/qt5/qtquick/qml-qtquick-vector3danimation.html
  9103. share/doc/qt5/qtquick/qml-qtquick-viewtransition-members.html
  9104. share/doc/qt5/qtquick/qml-qtquick-viewtransition.html
  9105. share/doc/qt5/qtquick/qml-qtquick-wheelevent-members.html
  9106. share/doc/qt5/qtquick/qml-qtquick-wheelevent.html
  9107. share/doc/qt5/qtquick/qml-qtquick-window-closeevent-members.html
  9108. share/doc/qt5/qtquick/qml-qtquick-window-closeevent.html
  9109. share/doc/qt5/qtquick/qml-qtquick-window-screen-members.html
  9110. share/doc/qt5/qtquick/qml-qtquick-window-screen-obsolete.html
  9111. share/doc/qt5/qtquick/qml-qtquick-window-screen.html
  9112. share/doc/qt5/qtquick/qml-qtquick-window-window-members.html
  9113. share/doc/qt5/qtquick/qml-qtquick-window-window.html
  9114. share/doc/qt5/qtquick/qml-qtquick-xanimator-members.html
  9115. share/doc/qt5/qtquick/qml-qtquick-xanimator.html
  9116. share/doc/qt5/qtquick/qml-qtquick-yanimator-members.html
  9117. share/doc/qt5/qtquick/qml-qtquick-yanimator.html
  9118. share/doc/qt5/qtquick/qml-qttest-signalspy-members.html
  9119. share/doc/qt5/qtquick/qml-qttest-signalspy.html
  9120. share/doc/qt5/qtquick/qml-qttest-testcase-members.html
  9121. share/doc/qt5/qtquick/qml-qttest-testcase.html
  9122. share/doc/qt5/qtquick/qml-qttest-toucheventsequence-members.html
  9123. share/doc/qt5/qtquick/qml-qttest-toucheventsequence.html
  9124. share/doc/qt5/qtquick/qml-quaternion.html
  9125. share/doc/qt5/qtquick/qml-tutorial.html
  9126. share/doc/qt5/qtquick/qml-tutorial1.html
  9127. share/doc/qt5/qtquick/qml-tutorial2.html
  9128. share/doc/qt5/qtquick/qml-tutorial3.html
  9129. share/doc/qt5/qtquick/qml-vector2d.html
  9130. share/doc/qt5/qtquick/qml-vector3d.html
  9131. share/doc/qt5/qtquick/qml-vector4d.html
  9132. share/doc/qt5/qtquick/qmlexampletoggleswitch.html
  9133. share/doc/qt5/qtquick/qquickasyncimageprovider-members.html
  9134. share/doc/qt5/qtquick/qquickasyncimageprovider.html
  9135. share/doc/qt5/qtquick/qquickframebufferobject-members.html
  9136. share/doc/qt5/qtquick/qquickframebufferobject-obsolete.html
  9137. share/doc/qt5/qtquick/qquickframebufferobject-renderer-members.html
  9138. share/doc/qt5/qtquick/qquickframebufferobject-renderer.html
  9139. share/doc/qt5/qtquick/qquickframebufferobject.html
  9140. share/doc/qt5/qtquick/qquickimageprovider-members.html
  9141. share/doc/qt5/qtquick/qquickimageprovider.html
  9142. share/doc/qt5/qtquick/qquickimageresponse-members.html
  9143. share/doc/qt5/qtquick/qquickimageresponse-obsolete.html
  9144. share/doc/qt5/qtquick/qquickimageresponse.html
  9145. share/doc/qt5/qtquick/qquickitem-itemchangedata-members.html
  9146. share/doc/qt5/qtquick/qquickitem-itemchangedata.html
  9147. share/doc/qt5/qtquick/qquickitem-members.html
  9148. share/doc/qt5/qtquick/qquickitem-obsolete.html
  9149. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata-members.html
  9150. share/doc/qt5/qtquick/qquickitem-updatepaintnodedata.html
  9151. share/doc/qt5/qtquick/qquickitem.html
  9152. share/doc/qt5/qtquick/qquickitemgrabresult-members.html
  9153. share/doc/qt5/qtquick/qquickitemgrabresult-obsolete.html
  9154. share/doc/qt5/qtquick/qquickitemgrabresult.html
  9155. share/doc/qt5/qtquick/qquickpainteditem-members.html
  9156. share/doc/qt5/qtquick/qquickpainteditem-obsolete.html
  9157. share/doc/qt5/qtquick/qquickpainteditem.html
  9158. share/doc/qt5/qtquick/qquickrendercontrol-members.html
  9159. share/doc/qt5/qtquick/qquickrendercontrol-obsolete.html
  9160. share/doc/qt5/qtquick/qquickrendercontrol.html
  9161. share/doc/qt5/qtquick/qquicktextdocument-members.html
  9162. share/doc/qt5/qtquick/qquicktextdocument-obsolete.html
  9163. share/doc/qt5/qtquick/qquicktextdocument.html
  9164. share/doc/qt5/qtquick/qquicktexturefactory-members.html
  9165. share/doc/qt5/qtquick/qquicktexturefactory-obsolete.html
  9166. share/doc/qt5/qtquick/qquicktexturefactory.html
  9167. share/doc/qt5/qtquick/qquickview-members.html
  9168. share/doc/qt5/qtquick/qquickview-obsolete.html
  9169. share/doc/qt5/qtquick/qquickview.html
  9170. share/doc/qt5/qtquick/qquickwidget-members.html
  9171. share/doc/qt5/qtquick/qquickwidget-obsolete.html
  9172. share/doc/qt5/qtquick/qquickwidget.html
  9173. share/doc/qt5/qtquick/qquickwindow-members.html
  9174. share/doc/qt5/qtquick/qquickwindow-obsolete.html
  9175. share/doc/qt5/qtquick/qquickwindow.html
  9176. share/doc/qt5/qtquick/qsgabstractrenderer-members.html
  9177. share/doc/qt5/qtquick/qsgabstractrenderer-obsolete.html
  9178. share/doc/qt5/qtquick/qsgabstractrenderer.html
  9179. share/doc/qt5/qtquick/qsgbasicgeometrynode-members.html
  9180. share/doc/qt5/qtquick/qsgbasicgeometrynode.html
  9181. share/doc/qt5/qtquick/qsgclipnode-members.html
  9182. share/doc/qt5/qtquick/qsgclipnode.html
  9183. share/doc/qt5/qtquick/qsgdynamictexture-members.html
  9184. share/doc/qt5/qtquick/qsgdynamictexture-obsolete.html
  9185. share/doc/qt5/qtquick/qsgdynamictexture.html
  9186. share/doc/qt5/qtquick/qsgengine-members.html
  9187. share/doc/qt5/qtquick/qsgengine-obsolete.html
  9188. share/doc/qt5/qtquick/qsgengine.html
  9189. share/doc/qt5/qtquick/qsgflatcolormaterial-members.html
  9190. share/doc/qt5/qtquick/qsgflatcolormaterial.html
  9191. share/doc/qt5/qtquick/qsggeometry-attribute-members.html
  9192. share/doc/qt5/qtquick/qsggeometry-attribute.html
  9193. share/doc/qt5/qtquick/qsggeometry-attributeset-members.html
  9194. share/doc/qt5/qtquick/qsggeometry-attributeset.html
  9195. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d-members.html
  9196. share/doc/qt5/qtquick/qsggeometry-coloredpoint2d.html
  9197. share/doc/qt5/qtquick/qsggeometry-members.html
  9198. share/doc/qt5/qtquick/qsggeometry-point2d-members.html
  9199. share/doc/qt5/qtquick/qsggeometry-point2d.html
  9200. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d-members.html
  9201. share/doc/qt5/qtquick/qsggeometry-texturedpoint2d.html
  9202. share/doc/qt5/qtquick/qsggeometry.html
  9203. share/doc/qt5/qtquick/qsggeometrynode-members.html
  9204. share/doc/qt5/qtquick/qsggeometrynode.html
  9205. share/doc/qt5/qtquick/qsgimagenode-members.html
  9206. share/doc/qt5/qtquick/qsgimagenode.html
  9207. share/doc/qt5/qtquick/qsgmaterial-members.html
  9208. share/doc/qt5/qtquick/qsgmaterial.html
  9209. share/doc/qt5/qtquick/qsgmaterialshader-members.html
  9210. share/doc/qt5/qtquick/qsgmaterialshader-renderstate-members.html
  9211. share/doc/qt5/qtquick/qsgmaterialshader-renderstate.html
  9212. share/doc/qt5/qtquick/qsgmaterialshader.html
  9213. share/doc/qt5/qtquick/qsgmaterialtype.html
  9214. share/doc/qt5/qtquick/qsgnode-members.html
  9215. share/doc/qt5/qtquick/qsgnode.html
  9216. share/doc/qt5/qtquick/qsgopacitynode-members.html
  9217. share/doc/qt5/qtquick/qsgopacitynode.html
  9218. share/doc/qt5/qtquick/qsgopaquetexturematerial-members.html
  9219. share/doc/qt5/qtquick/qsgopaquetexturematerial.html
  9220. share/doc/qt5/qtquick/qsgrectanglenode-members.html
  9221. share/doc/qt5/qtquick/qsgrectanglenode.html
  9222. share/doc/qt5/qtquick/qsgrendererinterface-members.html
  9223. share/doc/qt5/qtquick/qsgrendererinterface.html
  9224. share/doc/qt5/qtquick/qsgrendernode-members.html
  9225. share/doc/qt5/qtquick/qsgrendernode-renderstate-members.html
  9226. share/doc/qt5/qtquick/qsgrendernode-renderstate.html
  9227. share/doc/qt5/qtquick/qsgrendernode.html
  9228. share/doc/qt5/qtquick/qsgsimplematerial-members.html
  9229. share/doc/qt5/qtquick/qsgsimplematerial.html
  9230. share/doc/qt5/qtquick/qsgsimplematerialshader-members.html
  9231. share/doc/qt5/qtquick/qsgsimplematerialshader.html
  9232. share/doc/qt5/qtquick/qsgsimplerectnode-members.html
  9233. share/doc/qt5/qtquick/qsgsimplerectnode.html
  9234. share/doc/qt5/qtquick/qsgsimpletexturenode-members.html
  9235. share/doc/qt5/qtquick/qsgsimpletexturenode.html
  9236. share/doc/qt5/qtquick/qsgtexture-members.html
  9237. share/doc/qt5/qtquick/qsgtexture-obsolete.html
  9238. share/doc/qt5/qtquick/qsgtexture.html
  9239. share/doc/qt5/qtquick/qsgtexturematerial-members.html
  9240. share/doc/qt5/qtquick/qsgtexturematerial.html
  9241. share/doc/qt5/qtquick/qsgtextureprovider-members.html
  9242. share/doc/qt5/qtquick/qsgtextureprovider-obsolete.html
  9243. share/doc/qt5/qtquick/qsgtextureprovider.html
  9244. share/doc/qt5/qtquick/qsgtransformnode-members.html
  9245. share/doc/qt5/qtquick/qsgtransformnode.html
  9246. share/doc/qt5/qtquick/qsgvertexcolormaterial-members.html
  9247. share/doc/qt5/qtquick/qsgvertexcolormaterial.html
  9248. share/doc/qt5/qtquick/qt-labs-folderlistmodel-qmlmodule.html
  9249. share/doc/qt5/qtquick/qt-labs-qmlmodels-qmlmodule.html
  9250. share/doc/qt5/qtquick/qt-labs-settings-qmlmodule.html
  9251. share/doc/qt5/qtquick/qt-labs-sharedimage-qmlmodule.html
  9252. share/doc/qt5/qtquick/qt-labs-wavefrontmesh-qmlmodule.html
  9253. share/doc/qt5/qtquick/qtquick-animation-animation-pro.html
  9254. share/doc/qt5/qtquick/qtquick-animation-animation-qml.html
  9255. share/doc/qt5/qtquick/qtquick-animation-animation-qmlproject.html
  9256. share/doc/qt5/qtquick/qtquick-animation-animation-qrc.html
  9257. share/doc/qt5/qtquick/qtquick-animation-basics-animators-qml.html
  9258. share/doc/qt5/qtquick/qtquick-animation-basics-color-animation-qml.html
  9259. share/doc/qt5/qtquick/qtquick-animation-basics-property-animation-qml.html
  9260. share/doc/qt5/qtquick/qtquick-animation-behaviors-behavior-example-qml.html
  9261. share/doc/qt5/qtquick/qtquick-animation-behaviors-siderect-qml.html
  9262. share/doc/qt5/qtquick/qtquick-animation-behaviors-tvtennis-qml.html
  9263. share/doc/qt5/qtquick/qtquick-animation-behaviors-wigglytext-qml.html
  9264. share/doc/qt5/qtquick/qtquick-animation-easing-easing-qml.html
  9265. share/doc/qt5/qtquick/qtquick-animation-example.html
  9266. share/doc/qt5/qtquick/qtquick-animation-main-cpp.html
  9267. share/doc/qt5/qtquick/qtquick-animation-pathanimation-pathanimation-qml.html
  9268. share/doc/qt5/qtquick/qtquick-animation-pathinterpolator-pathinterpolator-qml.html
  9269. share/doc/qt5/qtquick/qtquick-animation-states-states-qml.html
  9270. share/doc/qt5/qtquick/qtquick-animation-states-transitions-qml.html
  9271. share/doc/qt5/qtquick/qtquick-bestpractices.html
  9272. share/doc/qt5/qtquick/qtquick-canvas-beziercurve-beziercurve-qml.html
  9273. share/doc/qt5/qtquick/qtquick-canvas-canvas-pro.html
  9274. share/doc/qt5/qtquick/qtquick-canvas-canvas-qml.html
  9275. share/doc/qt5/qtquick/qtquick-canvas-canvas-qrc.html
  9276. share/doc/qt5/qtquick/qtquick-canvas-clip-clip-qml.html
  9277. share/doc/qt5/qtquick/qtquick-canvas-example.html
  9278. share/doc/qt5/qtquick/qtquick-canvas-main-cpp.html
  9279. share/doc/qt5/qtquick/qtquick-canvas-quadraticcurveto-quadraticcurveto-qml.html
  9280. share/doc/qt5/qtquick/qtquick-canvas-roundedrect-roundedrect-qml.html
  9281. share/doc/qt5/qtquick/qtquick-canvas-smile-smile-qml.html
  9282. share/doc/qt5/qtquick/qtquick-canvas-squircle-squircle-qml.html
  9283. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-js.html
  9284. share/doc/qt5/qtquick/qtquick-canvas-tiger-tiger-qml.html
  9285. share/doc/qt5/qtquick/qtquick-codesamples.html
  9286. share/doc/qt5/qtquick/qtquick-convenience-topic.html
  9287. share/doc/qt5/qtquick/qtquick-cppextensionpoints.html
  9288. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-dial-qml.html
  9289. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-content-quitbutton-qml.html
  9290. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-pro.html
  9291. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qml.html
  9292. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qmlproject.html
  9293. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-dialcontrol-qrc.html
  9294. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-example.html
  9295. share/doc/qt5/qtquick/qtquick-customitems-dialcontrol-main-cpp.html
  9296. share/doc/qt5/qtquick/qtquick-customitems-flipable-content-card-qml.html
  9297. share/doc/qt5/qtquick/qtquick-customitems-flipable-example.html
  9298. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qml.html
  9299. share/doc/qt5/qtquick/qtquick-customitems-flipable-flipable-qmlproject.html
  9300. share/doc/qt5/qtquick/qtquick-customitems-painteditem-example.html
  9301. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-pro.html
  9302. share/doc/qt5/qtquick/qtquick-customitems-painteditem-painteditem-qrc.html
  9303. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-cpp.html
  9304. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoon-h.html
  9305. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-plugin-h.html
  9306. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoonplugin-qmldir.html
  9307. share/doc/qt5/qtquick/qtquick-customitems-painteditem-textballoons-qml.html
  9308. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-example.html
  9309. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-main-qml.html
  9310. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qml.html
  9311. share/doc/qt5/qtquick/qtquick-customitems-scrollbar-scrollbar-qmlproject.html
  9312. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-example.html
  9313. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-main-qml.html
  9314. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qml.html
  9315. share/doc/qt5/qtquick/qtquick-customitems-tabwidget-tabwidget-qmlproject.html
  9316. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-pro.html
  9317. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qml.html
  9318. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qmlproject.html
  9319. share/doc/qt5/qtquick/qtquick-draganddrop-draganddrop-qrc.html
  9320. share/doc/qt5/qtquick/qtquick-draganddrop-example.html
  9321. share/doc/qt5/qtquick/qtquick-draganddrop-main-cpp.html
  9322. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-dragtile-qml.html
  9323. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-droptile-qml.html
  9324. share/doc/qt5/qtquick/qtquick-draganddrop-tiles-tiles-qml.html
  9325. share/doc/qt5/qtquick/qtquick-draganddrop-views-gridview-qml.html
  9326. share/doc/qt5/qtquick/qtquick-effects-particles.html
  9327. share/doc/qt5/qtquick/qtquick-effects-sprites.html
  9328. share/doc/qt5/qtquick/qtquick-effects-topic.html
  9329. share/doc/qt5/qtquick/qtquick-effects-transformations.html
  9330. share/doc/qt5/qtquick/qtquick-externaldraganddrop-draganddroptextitem-qml.html
  9331. share/doc/qt5/qtquick/qtquick-externaldraganddrop-example.html
  9332. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-pro.html
  9333. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qml.html
  9334. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qmlproject.html
  9335. share/doc/qt5/qtquick/qtquick-externaldraganddrop-externaldraganddrop-qrc.html
  9336. share/doc/qt5/qtquick/qtquick-externaldraganddrop-main-cpp.html
  9337. share/doc/qt5/qtquick/qtquick-imageelements-animatedimage-qml.html
  9338. share/doc/qt5/qtquick/qtquick-imageelements-animatedsprite-qml.html
  9339. share/doc/qt5/qtquick/qtquick-imageelements-borderimage-qml.html
  9340. share/doc/qt5/qtquick/qtquick-imageelements-content-borderimageselector-qml.html
  9341. share/doc/qt5/qtquick/qtquick-imageelements-content-imagecell-qml.html
  9342. share/doc/qt5/qtquick/qtquick-imageelements-content-myborderimage-qml.html
  9343. share/doc/qt5/qtquick/qtquick-imageelements-content-shadowrectangle-qml.html
  9344. share/doc/qt5/qtquick/qtquick-imageelements-example.html
  9345. share/doc/qt5/qtquick/qtquick-imageelements-image-qml.html
  9346. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-pro.html
  9347. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qml.html
  9348. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qmlproject.html
  9349. share/doc/qt5/qtquick/qtquick-imageelements-imageelements-qrc.html
  9350. share/doc/qt5/qtquick/qtquick-imageelements-main-cpp.html
  9351. share/doc/qt5/qtquick/qtquick-imageelements-shadows-qml.html
  9352. share/doc/qt5/qtquick/qtquick-imageelements-spritesequence-qml.html
  9353. share/doc/qt5/qtquick/qtquick-imageprovider-example.html
  9354. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-cpp.html
  9355. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-example-qml.html
  9356. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-pro.html
  9357. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovider-qmlproject.html
  9358. share/doc/qt5/qtquick/qtquick-imageprovider-imageprovidercore-qmldir.html
  9359. share/doc/qt5/qtquick/qtquick-imageresponseprovider-example.html
  9360. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-cpp.html
  9361. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-example-qml.html
  9362. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-pro.html
  9363. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovider-qmlproject.html
  9364. share/doc/qt5/qtquick/qtquick-imageresponseprovider-imageresponseprovidercore-qmldir.html
  9365. share/doc/qt5/qtquick/qtquick-index.html
  9366. share/doc/qt5/qtquick/qtquick-input-focus.html
  9367. share/doc/qt5/qtquick/qtquick-input-mouseevents.html
  9368. share/doc/qt5/qtquick/qtquick-input-textinput.html
  9369. share/doc/qt5/qtquick/qtquick-input-topic.html
  9370. share/doc/qt5/qtquick/qtquick-keyinteraction-example.html
  9371. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-contextmenu-qml.html
  9372. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-gridmenu-qml.html
  9373. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listmenu-qml.html
  9374. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-listviewdelegate-qml.html
  9375. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-core-tabmenu-qml.html
  9376. share/doc/qt5/qtquick/qtquick-keyinteraction-focus-focus-qml.html
  9377. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-pro.html
  9378. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qml.html
  9379. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qmlproject.html
  9380. share/doc/qt5/qtquick/qtquick-keyinteraction-keyinteraction-qrc.html
  9381. share/doc/qt5/qtquick/qtquick-keyinteraction-main-cpp.html
  9382. share/doc/qt5/qtquick/qtquick-layouts-example.html
  9383. share/doc/qt5/qtquick/qtquick-layouts-layouts-pro.html
  9384. share/doc/qt5/qtquick/qtquick-layouts-layouts-qml.html
  9385. share/doc/qt5/qtquick/qtquick-layouts-layouts-qmlproject.html
  9386. share/doc/qt5/qtquick/qtquick-layouts-layouts-qrc.html
  9387. share/doc/qt5/qtquick/qtquick-layouts-main-cpp.html
  9388. share/doc/qt5/qtquick/qtquick-layouts-qmlmodule.html
  9389. share/doc/qt5/qtquick/qtquick-localstorage-example.html
  9390. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-database-js.html
  9391. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-header-qml.html
  9392. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-pro.html
  9393. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qml.html
  9394. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-localstorage-qrc.html
  9395. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-main-cpp.html
  9396. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mybutton-qml.html
  9397. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mydelegate-qml.html
  9398. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-mymodel-qml.html
  9399. share/doc/qt5/qtquick/qtquick-localstorage-localstorage-pro.html
  9400. share/doc/qt5/qtquick/qtquick-localstorage-qmlmodule.html
  9401. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-pro.html
  9402. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-abstractitemmodel-qrc.html
  9403. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-example.html
  9404. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-main-cpp.html
  9405. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-cpp.html
  9406. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-model-h.html
  9407. share/doc/qt5/qtquick/qtquick-models-abstractitemmodel-view-qml.html
  9408. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-cpp.html
  9409. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-dataobject-h.html
  9410. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-example.html
  9411. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-main-cpp.html
  9412. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-pro.html
  9413. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-objectlistmodel-qrc.html
  9414. share/doc/qt5/qtquick/qtquick-models-objectlistmodel-view-qml.html
  9415. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-example.html
  9416. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-main-cpp.html
  9417. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-pro.html
  9418. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-stringlistmodel-qrc.html
  9419. share/doc/qt5/qtquick/qtquick-models-stringlistmodel-view-qml.html
  9420. share/doc/qt5/qtquick/qtquick-modelviewsdata-cppmodels.html
  9421. share/doc/qt5/qtquick/qtquick-modelviewsdata-modelview.html
  9422. share/doc/qt5/qtquick/qtquick-modelviewsdata-topic.html
  9423. share/doc/qt5/qtquick/qtquick-module.html
  9424. share/doc/qt5/qtquick/qtquick-mousearea-example.html
  9425. share/doc/qt5/qtquick/qtquick-mousearea-main-cpp.html
  9426. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-pro.html
  9427. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qml.html
  9428. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qmlproject.html
  9429. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-qrc.html
  9430. share/doc/qt5/qtquick/qtquick-mousearea-mousearea-wheel-example-qml.html
  9431. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-pro.html
  9432. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qml.html
  9433. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qmlproject.html
  9434. share/doc/qt5/qtquick/qtquick-particles-affectors-affectors-qrc.html
  9435. share/doc/qt5/qtquick/qtquick-particles-affectors-content-age-qml.html
  9436. share/doc/qt5/qtquick/qtquick-particles-affectors-content-attractor-qml.html
  9437. share/doc/qt5/qtquick/qtquick-particles-affectors-content-customaffector-qml.html
  9438. share/doc/qt5/qtquick/qtquick-particles-affectors-content-friction-qml.html
  9439. share/doc/qt5/qtquick/qtquick-particles-affectors-content-gravity-qml.html
  9440. share/doc/qt5/qtquick/qtquick-particles-affectors-content-greybutton-qml.html
  9441. share/doc/qt5/qtquick/qtquick-particles-affectors-content-groupgoal-qml.html
  9442. share/doc/qt5/qtquick/qtquick-particles-affectors-content-move-qml.html
  9443. share/doc/qt5/qtquick/qtquick-particles-affectors-content-spritegoal-qml.html
  9444. share/doc/qt5/qtquick/qtquick-particles-affectors-content-turbulence-qml.html
  9445. share/doc/qt5/qtquick/qtquick-particles-affectors-content-wander-qml.html
  9446. share/doc/qt5/qtquick/qtquick-particles-affectors-example.html
  9447. share/doc/qt5/qtquick/qtquick-particles-affectors-main-cpp.html
  9448. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-blurparticles-qml.html
  9449. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-fragmentshader-qml.html
  9450. share/doc/qt5/qtquick/qtquick-particles-customparticle-content-imagecolors-qml.html
  9451. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-pro.html
  9452. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qml.html
  9453. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qmlproject.html
  9454. share/doc/qt5/qtquick/qtquick-particles-customparticle-customparticle-qrc.html
  9455. share/doc/qt5/qtquick/qtquick-particles-customparticle-example.html
  9456. share/doc/qt5/qtquick/qtquick-particles-customparticle-main-cpp.html
  9457. share/doc/qt5/qtquick/qtquick-particles-emitters-content-burstandpulse-qml.html
  9458. share/doc/qt5/qtquick/qtquick-particles-emitters-content-customemitter-qml.html
  9459. share/doc/qt5/qtquick/qtquick-particles-emitters-content-emitmask-qml.html
  9460. share/doc/qt5/qtquick/qtquick-particles-emitters-content-maximumemitted-qml.html
  9461. share/doc/qt5/qtquick/qtquick-particles-emitters-content-shapeanddirection-qml.html
  9462. share/doc/qt5/qtquick/qtquick-particles-emitters-content-trailemitter-qml.html
  9463. share/doc/qt5/qtquick/qtquick-particles-emitters-content-velocityfrommotion-qml.html
  9464. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-pro.html
  9465. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qml.html
  9466. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qmlproject.html
  9467. share/doc/qt5/qtquick/qtquick-particles-emitters-emitters-qrc.html
  9468. share/doc/qt5/qtquick/qtquick-particles-emitters-example.html
  9469. share/doc/qt5/qtquick/qtquick-particles-emitters-main-cpp.html
  9470. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-allatonce-qml.html
  9471. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colored-qml.html
  9472. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-colortable-qml.html
  9473. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-deformation-qml.html
  9474. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-rotation-qml.html
  9475. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sharing-qml.html
  9476. share/doc/qt5/qtquick/qtquick-particles-imageparticle-content-sprites-qml.html
  9477. share/doc/qt5/qtquick/qtquick-particles-imageparticle-example.html
  9478. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-pro.html
  9479. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qml.html
  9480. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qmlproject.html
  9481. share/doc/qt5/qtquick/qtquick-particles-imageparticle-imageparticle-qrc.html
  9482. share/doc/qt5/qtquick/qtquick-particles-imageparticle-main-cpp.html
  9483. share/doc/qt5/qtquick/qtquick-particles-performance.html
  9484. share/doc/qt5/qtquick/qtquick-particles-qmlmodule.html
  9485. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamiccomparison-qml.html
  9486. share/doc/qt5/qtquick/qtquick-particles-system-content-dynamicemitters-qml.html
  9487. share/doc/qt5/qtquick/qtquick-particles-system-content-multiplepainters-qml.html
  9488. share/doc/qt5/qtquick/qtquick-particles-system-content-startstop-qml.html
  9489. share/doc/qt5/qtquick/qtquick-particles-system-content-timedgroupchanges-qml.html
  9490. share/doc/qt5/qtquick/qtquick-particles-system-example.html
  9491. share/doc/qt5/qtquick/qtquick-particles-system-main-cpp.html
  9492. share/doc/qt5/qtquick/qtquick-particles-system-system-pro.html
  9493. share/doc/qt5/qtquick/qtquick-particles-system-system-qml.html
  9494. share/doc/qt5/qtquick/qtquick-particles-system-system-qmlproject.html
  9495. share/doc/qt5/qtquick/qtquick-particles-system-system-qrc.html
  9496. share/doc/qt5/qtquick/qtquick-positioners-example.html
  9497. share/doc/qt5/qtquick/qtquick-positioners-main-cpp.html
  9498. share/doc/qt5/qtquick/qtquick-positioners-positioners-attachedproperties-qml.html
  9499. share/doc/qt5/qtquick/qtquick-positioners-positioners-pro.html
  9500. share/doc/qt5/qtquick/qtquick-positioners-positioners-qml.html
  9501. share/doc/qt5/qtquick/qtquick-positioners-positioners-qmlproject.html
  9502. share/doc/qt5/qtquick/qtquick-positioners-positioners-qrc.html
  9503. share/doc/qt5/qtquick/qtquick-positioners-positioners-transitions-qml.html
  9504. share/doc/qt5/qtquick/qtquick-positioning-anchors.html
  9505. share/doc/qt5/qtquick/qtquick-positioning-layouts.html
  9506. share/doc/qt5/qtquick/qtquick-positioning-righttoleft.html
  9507. share/doc/qt5/qtquick/qtquick-positioning-topic.html
  9508. share/doc/qt5/qtquick/qtquick-qmlmodule.html
  9509. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qml.html
  9510. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qmlproject.html
  9511. share/doc/qt5/qtquick/qtquick-quick-accessibility-accessibility-qrc.html
  9512. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-button-qml.html
  9513. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-checkbox-qml.html
  9514. share/doc/qt5/qtquick/qtquick-quick-accessibility-content-slider-qml.html
  9515. share/doc/qt5/qtquick/qtquick-quick-accessibility-example.html
  9516. share/doc/qt5/qtquick/qtquick-quick-accessibility-main-cpp.html
  9517. share/doc/qt5/qtquick/qtquick-quick-accessibility-quick-accessibility-pro.html
  9518. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-customgl-qml.html
  9519. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-example.html
  9520. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-cpp.html
  9521. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-fbitem-h.html
  9522. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-main-cpp.html
  9523. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-pro.html
  9524. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-quickwidget-qrc.html
  9525. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquare-qml.html
  9526. share/doc/qt5/qtquick/qtquick-quickwidgets-quickwidget-rotatingsquaretab-qml.html
  9527. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-cpp.html
  9528. share/doc/qt5/qtquick/qtquick-rendercontrol-cuberenderer-h.html
  9529. share/doc/qt5/qtquick/qtquick-rendercontrol-demo-qml.html
  9530. share/doc/qt5/qtquick/qtquick-rendercontrol-example.html
  9531. share/doc/qt5/qtquick/qtquick-rendercontrol-main-cpp.html
  9532. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-pro.html
  9533. share/doc/qt5/qtquick/qtquick-rendercontrol-rendercontrol-qrc.html
  9534. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-cpp.html
  9535. share/doc/qt5/qtquick/qtquick-rendercontrol-window-multithreaded-h.html
  9536. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-cpp.html
  9537. share/doc/qt5/qtquick/qtquick-rendercontrol-window-singlethreaded-h.html
  9538. share/doc/qt5/qtquick/qtquick-righttoleft-example.html
  9539. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qml.html
  9540. share/doc/qt5/qtquick/qtquick-righttoleft-layoutdirection-layoutdirection-qmlproject.html
  9541. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qml.html
  9542. share/doc/qt5/qtquick/qtquick-righttoleft-layoutmirroring-layoutmirroring-qmlproject.html
  9543. share/doc/qt5/qtquick/qtquick-righttoleft-main-cpp.html
  9544. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-pro.html
  9545. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qml.html
  9546. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qmlproject.html
  9547. share/doc/qt5/qtquick/qtquick-righttoleft-righttoleft-qrc.html
  9548. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qml.html
  9549. share/doc/qt5/qtquick/qtquick-righttoleft-textalignment-textalignment-qmlproject.html
  9550. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-cpp.html
  9551. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-beziercurve-h.html
  9552. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-pro.html
  9553. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-customgeometry-qrc.html
  9554. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-example.html
  9555. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-cpp.html
  9556. share/doc/qt5/qtquick/qtquick-scenegraph-customgeometry-main-qml.html
  9557. share/doc/qt5/qtquick/qtquick-scenegraph-graph-example.html
  9558. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-cpp.html
  9559. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-h.html
  9560. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-pro.html
  9561. share/doc/qt5/qtquick/qtquick-scenegraph-graph-graph-qrc.html
  9562. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-cpp.html
  9563. share/doc/qt5/qtquick/qtquick-scenegraph-graph-gridnode-h.html
  9564. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-cpp.html
  9565. share/doc/qt5/qtquick/qtquick-scenegraph-graph-linenode-h.html
  9566. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-cpp.html
  9567. share/doc/qt5/qtquick/qtquick-scenegraph-graph-main-qml.html
  9568. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-cpp.html
  9569. share/doc/qt5/qtquick/qtquick-scenegraph-graph-noisynode-h.html
  9570. share/doc/qt5/qtquick/qtquick-scenegraph-materials.html
  9571. share/doc/qt5/qtquick/qtquick-scenegraph-nodes.html
  9572. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-example.html
  9573. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-cpp.html
  9574. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-main-qml.html
  9575. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-pro.html
  9576. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-openglunderqml-qrc.html
  9577. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-cpp.html
  9578. share/doc/qt5/qtquick/qtquick-scenegraph-openglunderqml-squircle-h.html
  9579. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-example.html
  9580. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-main-qml.html
  9581. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-cpp.html
  9582. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-pro.html
  9583. share/doc/qt5/qtquick/qtquick-scenegraph-simplematerial-simplematerial-qrc.html
  9584. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-example.html
  9585. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-cpp.html
  9586. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-fboinsgrenderer-h.html
  9587. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-cpp.html
  9588. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-main-qml.html
  9589. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-pro.html
  9590. share/doc/qt5/qtquick/qtquick-scenegraph-textureinsgnode-textureinsgnode-qrc.html
  9591. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-error-qml.html
  9592. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-example.html
  9593. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-cpp.html
  9594. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-main-qml.html
  9595. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-pro.html
  9596. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-textureinthread-qrc.html
  9597. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-cpp.html
  9598. share/doc/qt5/qtquick/qtquick-scenegraph-textureinthread-threadrenderer-h.html
  9599. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-example.html
  9600. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-cpp.html
  9601. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-main-qml.html
  9602. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-pro.html
  9603. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-twotextureproviders-qrc.html
  9604. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-cpp.html
  9605. share/doc/qt5/qtquick/qtquick-scenegraph-twotextureproviders-xorblender-h.html
  9606. share/doc/qt5/qtquick/qtquick-shadereffects-content-slider-qml.html
  9607. share/doc/qt5/qtquick/qtquick-shadereffects-example.html
  9608. share/doc/qt5/qtquick/qtquick-shadereffects-main-cpp.html
  9609. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-pro.html
  9610. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qml.html
  9611. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qmlproject.html
  9612. share/doc/qt5/qtquick/qtquick-shadereffects-shadereffects-qrc.html
  9613. share/doc/qt5/qtquick/qtquick-shapes-content-clippedtigers-qml.html
  9614. share/doc/qt5/qtquick/qtquick-shapes-content-interactive-qml.html
  9615. share/doc/qt5/qtquick/qtquick-shapes-content-item10-qml.html
  9616. share/doc/qt5/qtquick/qtquick-shapes-content-item11-qml.html
  9617. share/doc/qt5/qtquick/qtquick-shapes-content-item12-qml.html
  9618. share/doc/qt5/qtquick/qtquick-shapes-content-item13-qml.html
  9619. share/doc/qt5/qtquick/qtquick-shapes-content-item14-qml.html
  9620. share/doc/qt5/qtquick/qtquick-shapes-content-item15-qml.html
  9621. share/doc/qt5/qtquick/qtquick-shapes-content-item17-qml.html
  9622. share/doc/qt5/qtquick/qtquick-shapes-content-item2-qml.html
  9623. share/doc/qt5/qtquick/qtquick-shapes-content-item3-qml.html
  9624. share/doc/qt5/qtquick/qtquick-shapes-content-item4-qml.html
  9625. share/doc/qt5/qtquick/qtquick-shapes-content-item5-qml.html
  9626. share/doc/qt5/qtquick/qtquick-shapes-content-item6-qml.html
  9627. share/doc/qt5/qtquick/qtquick-shapes-content-item7-qml.html
  9628. share/doc/qt5/qtquick/qtquick-shapes-content-item8-qml.html
  9629. share/doc/qt5/qtquick/qtquick-shapes-content-item9-qml.html
  9630. share/doc/qt5/qtquick/qtquick-shapes-content-main-qml.html
  9631. share/doc/qt5/qtquick/qtquick-shapes-content-sampling-qml.html
  9632. share/doc/qt5/qtquick/qtquick-shapes-content-shapegallery-qml.html
  9633. share/doc/qt5/qtquick/qtquick-shapes-content-tapabletriangle-qml.html
  9634. share/doc/qt5/qtquick/qtquick-shapes-content-tiger-qml.html
  9635. share/doc/qt5/qtquick/qtquick-shapes-example.html
  9636. share/doc/qt5/qtquick/qtquick-shapes-main-cpp.html
  9637. share/doc/qt5/qtquick/qtquick-shapes-qmlmodule.html
  9638. share/doc/qt5/qtquick/qtquick-shapes-shapes-pro.html
  9639. share/doc/qt5/qtquick/qtquick-shapes-shapes-qrc.html
  9640. share/doc/qt5/qtquick/qtquick-statesanimations-animations.html
  9641. share/doc/qt5/qtquick/qtquick-statesanimations-behaviors.html
  9642. share/doc/qt5/qtquick/qtquick-statesanimations-states.html
  9643. share/doc/qt5/qtquick/qtquick-statesanimations-topic.html
  9644. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-example.html
  9645. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-gameoflife-pro.html
  9646. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-gameoflifemodel-cpp.html
  9647. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-gameoflifemodel-h.html
  9648. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-main-cpp.html
  9649. share/doc/qt5/qtquick/qtquick-tableview-gameoflife-main-qml.html
  9650. share/doc/qt5/qtquick/qtquick-tableview-pixelator-example.html
  9651. share/doc/qt5/qtquick/qtquick-tableview-pixelator-imagemodel-cpp.html
  9652. share/doc/qt5/qtquick/qtquick-tableview-pixelator-imagemodel-h.html
  9653. share/doc/qt5/qtquick/qtquick-tableview-pixelator-main-cpp.html
  9654. share/doc/qt5/qtquick/qtquick-tableview-pixelator-main-qml.html
  9655. share/doc/qt5/qtquick/qtquick-tableview-pixelator-pixelator-pro.html
  9656. share/doc/qt5/qtquick/qtquick-text-example.html
  9657. share/doc/qt5/qtquick/qtquick-text-fonts-availablefonts-qml.html
  9658. share/doc/qt5/qtquick/qtquick-text-fonts-banner-qml.html
  9659. share/doc/qt5/qtquick/qtquick-text-fonts-fonts-qml.html
  9660. share/doc/qt5/qtquick/qtquick-text-fonts-hello-qml.html
  9661. share/doc/qt5/qtquick/qtquick-text-imgtag-imgtag-qml.html
  9662. share/doc/qt5/qtquick/qtquick-text-imgtag-textwithimage-qml.html
  9663. share/doc/qt5/qtquick/qtquick-text-main-cpp.html
  9664. share/doc/qt5/qtquick/qtquick-text-styledtext-layout-qml.html
  9665. share/doc/qt5/qtquick/qtquick-text-text-pro.html
  9666. share/doc/qt5/qtquick/qtquick-text-text-qml.html
  9667. share/doc/qt5/qtquick/qtquick-text-text-qmlproject.html
  9668. share/doc/qt5/qtquick/qtquick-text-text-qrc.html
  9669. share/doc/qt5/qtquick/qtquick-text-textselection-textselection-qml.html
  9670. share/doc/qt5/qtquick/qtquick-text-validator.html
  9671. share/doc/qt5/qtquick/qtquick-threading-example.html
  9672. share/doc/qt5/qtquick/qtquick-threading-main-cpp.html
  9673. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-example.html
  9674. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-threadedlistmodel-qmlproject.html
  9675. share/doc/qt5/qtquick/qtquick-threading-threadedlistmodel-timedisplay-qml.html
  9676. share/doc/qt5/qtquick/qtquick-threading-threading-pro.html
  9677. share/doc/qt5/qtquick/qtquick-threading-threading-qml.html
  9678. share/doc/qt5/qtquick/qtquick-threading-threading-qmlproject.html
  9679. share/doc/qt5/qtquick/qtquick-threading-threading-qrc.html
  9680. share/doc/qt5/qtquick/qtquick-threading-workerscript-spinner-qml.html
  9681. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qml.html
  9682. share/doc/qt5/qtquick/qtquick-threading-workerscript-workerscript-qmlproject.html
  9683. share/doc/qt5/qtquick/qtquick-tools-and-utilities.html
  9684. share/doc/qt5/qtquick/qtquick-touchinteraction-example.html
  9685. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-basic-flickable-qml.html
  9686. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-content-panel-qml.html
  9687. share/doc/qt5/qtquick/qtquick-touchinteraction-flickable-corkboards-qml.html
  9688. share/doc/qt5/qtquick/qtquick-touchinteraction-main-cpp.html
  9689. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-bearwhack-qml.html
  9690. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-augmentedtouchpoint-qml.html
  9691. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-bearwhackparticlesystem-qml.html
  9692. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-content-particleflame-qml.html
  9693. share/doc/qt5/qtquick/qtquick-touchinteraction-multipointtouch-multiflame-qml.html
  9694. share/doc/qt5/qtquick/qtquick-touchinteraction-pincharea-flickresize-qml.html
  9695. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-pro.html
  9696. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qml.html
  9697. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qmlproject.html
  9698. share/doc/qt5/qtquick/qtquick-touchinteraction-touchinteraction-qrc.html
  9699. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview-qml.html
  9700. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-dynamicview1-qmlproject.html
  9701. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
  9702. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview1-petsmodel-qml.html
  9703. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview-qml.html
  9704. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-dynamicview2-qmlproject.html
  9705. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
  9706. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview2-petsmodel-qml.html
  9707. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview-qml.html
  9708. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-dynamicview3-qmlproject.html
  9709. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
  9710. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview3-petsmodel-qml.html
  9711. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview-qml.html
  9712. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-dynamicview4-qmlproject.html
  9713. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
  9714. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-listselector-qml.html
  9715. share/doc/qt5/qtquick/qtquick-tutorials-dynamicview-dynamicview4-petsmodel-qml.html
  9716. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-block-qml.html
  9717. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-button-qml.html
  9718. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-example.html
  9719. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame-qml.html
  9720. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame1-samegame1-qmlproject.html
  9721. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-block-qml.html
  9722. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-button-qml.html
  9723. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-example.html
  9724. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-js.html
  9725. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame-qml.html
  9726. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame2-samegame2-qmlproject.html
  9727. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-block-qml.html
  9728. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-button-qml.html
  9729. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-dialog-qml.html
  9730. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-example.html
  9731. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-js.html
  9732. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame-qml.html
  9733. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame3-samegame3-qmlproject.html
  9734. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-boomblock-qml.html
  9735. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-button-qml.html
  9736. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-dialog-qml.html
  9737. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-content-samegame-js.html
  9738. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-example.html
  9739. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-highscores-score-data-xml.html
  9740. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame-qml.html
  9741. share/doc/qt5/qtquick/qtquick-tutorials-samegame-samegame4-samegame4-qmlproject.html
  9742. share/doc/qt5/qtquick/qtquick-views-delegatemodel-delegatemodel-qmlproject.html
  9743. share/doc/qt5/qtquick/qtquick-views-delegatemodel-dragselection-qml.html
  9744. share/doc/qt5/qtquick/qtquick-views-delegatemodel-slideshow-qml.html
  9745. share/doc/qt5/qtquick/qtquick-views-example.html
  9746. share/doc/qt5/qtquick/qtquick-views-gridview-gridview-example-qml.html
  9747. share/doc/qt5/qtquick/qtquick-views-listview-content-petsmodel-qml.html
  9748. share/doc/qt5/qtquick/qtquick-views-listview-content-pressandholdbutton-qml.html
  9749. share/doc/qt5/qtquick/qtquick-views-listview-content-recipesmodel-qml.html
  9750. share/doc/qt5/qtquick/qtquick-views-listview-content-smalltext-qml.html
  9751. share/doc/qt5/qtquick/qtquick-views-listview-content-textbutton-qml.html
  9752. share/doc/qt5/qtquick/qtquick-views-listview-content-togglebutton-qml.html
  9753. share/doc/qt5/qtquick/qtquick-views-listview-displaymargin-qml.html
  9754. share/doc/qt5/qtquick/qtquick-views-listview-dynamiclist-qml.html
  9755. share/doc/qt5/qtquick/qtquick-views-listview-expandingdelegates-qml.html
  9756. share/doc/qt5/qtquick/qtquick-views-listview-highlight-qml.html
  9757. share/doc/qt5/qtquick/qtquick-views-listview-highlightranges-qml.html
  9758. share/doc/qt5/qtquick/qtquick-views-listview-sections-qml.html
  9759. share/doc/qt5/qtquick/qtquick-views-main-cpp.html
  9760. share/doc/qt5/qtquick/qtquick-views-objectmodel-objectmodel-qml.html
  9761. share/doc/qt5/qtquick/qtquick-views-package-delegate-qml.html
  9762. share/doc/qt5/qtquick/qtquick-views-package-view-qml.html
  9763. share/doc/qt5/qtquick/qtquick-views-pathview-pathview-example-qml.html
  9764. share/doc/qt5/qtquick/qtquick-views-views-pro.html
  9765. share/doc/qt5/qtquick/qtquick-views-views-qml.html
  9766. share/doc/qt5/qtquick/qtquick-views-views-qmlproject.html
  9767. share/doc/qt5/qtquick/qtquick-views-views-qrc.html
  9768. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-d3d12.html
  9769. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-openvg.html
  9770. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations-software.html
  9771. share/doc/qt5/qtquick/qtquick-visualcanvas-adaptations.html
  9772. share/doc/qt5/qtquick/qtquick-visualcanvas-coordinates.html
  9773. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
  9774. share/doc/qt5/qtquick/qtquick-visualcanvas-scenegraph.html
  9775. share/doc/qt5/qtquick/qtquick-visualcanvas-topic.html
  9776. share/doc/qt5/qtquick/qtquick-visualcanvas-visualparent.html
  9777. share/doc/qt5/qtquick/qtquick-visualtypes-topic.html
  9778. share/doc/qt5/qtquick/qtquick-window-allscreens-qml.html
  9779. share/doc/qt5/qtquick/qtquick-window-currentscreen-qml.html
  9780. share/doc/qt5/qtquick/qtquick-window-example.html
  9781. share/doc/qt5/qtquick/qtquick-window-main-cpp.html
  9782. share/doc/qt5/qtquick/qtquick-window-qmlmodule.html
  9783. share/doc/qt5/qtquick/qtquick-window-resources-icon-svg.html
  9784. share/doc/qt5/qtquick/qtquick-window-splash-qml.html
  9785. share/doc/qt5/qtquick/qtquick-window-window-pro.html
  9786. share/doc/qt5/qtquick/qtquick-window-window-qml.html
  9787. share/doc/qt5/qtquick/qtquick-window-window-qrc.html
  9788. share/doc/qt5/qtquick/qtquick.index
  9789. share/doc/qt5/qtquick/qtquick.qhp
  9790. share/doc/qt5/qtquick/qtquick.qhp.sha1
  9791. share/doc/qt5/qtquick/qtquick.tags
  9792. share/doc/qt5/qtquick/qtquickhandlers-index.html
  9793. share/doc/qt5/qtquick/qtquicklayouts-index.html
  9794. share/doc/qt5/qtquick/qtquicklayouts-overview.html
  9795. share/doc/qt5/qtquick/qtquickwidgets-module.html
  9796. share/doc/qt5/qtquick/qttest-qmlmodule.html
  9797. share/doc/qt5/qtquick/style/offline-simple.css
  9798. share/doc/qt5/qtquick/style/offline.css
  9799. share/doc/qt5/qtquickcontrols.qch
  9800. share/doc/qt5/qtquickcontrols/examples-manifest.xml
  9801. share/doc/qt5/qtquickcontrols/images/applicationwindow-background.png
  9802. share/doc/qt5/qtquickcontrols/images/applicationwindow-overlay-modal.png
  9803. share/doc/qt5/qtquickcontrols/images/applicationwindow-overlay.png
  9804. share/doc/qt5/qtquickcontrols/images/arrow_bc.png
  9805. share/doc/qt5/qtquickcontrols/images/bgrContent.png
  9806. share/doc/qt5/qtquickcontrols/images/btn_next.png
  9807. share/doc/qt5/qtquickcontrols/images/btn_prev.png
  9808. share/doc/qt5/qtquickcontrols/images/bullet_dn.png
  9809. share/doc/qt5/qtquickcontrols/images/bullet_sq.png
  9810. share/doc/qt5/qtquickcontrols/images/button-background-checked-disabled.9.png
  9811. share/doc/qt5/qtquickcontrols/images/button-background-checked-focused.9.png
  9812. share/doc/qt5/qtquickcontrols/images/button-background-checked-hovered.9.png
  9813. share/doc/qt5/qtquickcontrols/images/button-background-checked.9.png
  9814. share/doc/qt5/qtquickcontrols/images/button-background-disabled.9.png
  9815. share/doc/qt5/qtquickcontrols/images/button-background-flat-checked.9.png
  9816. share/doc/qt5/qtquickcontrols/images/button-background-flat-disabled.9.png
  9817. share/doc/qt5/qtquickcontrols/images/button-background-flat-hovered.9.png
  9818. share/doc/qt5/qtquickcontrols/images/button-background-flat-pressed.9.png
  9819. share/doc/qt5/qtquickcontrols/images/button-background-flat.9.png
  9820. share/doc/qt5/qtquickcontrols/images/button-background-focused.9.png
  9821. share/doc/qt5/qtquickcontrols/images/button-background-highlighted-checked.9.png
  9822. share/doc/qt5/qtquickcontrols/images/button-background-highlighted-disabled.9.png
  9823. share/doc/qt5/qtquickcontrols/images/button-background-highlighted-focused.9.png
  9824. share/doc/qt5/qtquickcontrols/images/button-background-highlighted-hovered.9.png
  9825. share/doc/qt5/qtquickcontrols/images/button-background-highlighted-pressed.9.png
  9826. share/doc/qt5/qtquickcontrols/images/button-background-highlighted.9.png
  9827. share/doc/qt5/qtquickcontrols/images/button-background-hovered.9.png
  9828. share/doc/qt5/qtquickcontrols/images/button-background-pressed.9.png
  9829. share/doc/qt5/qtquickcontrols/images/button-background.9.png
  9830. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-checked-focused.png
  9831. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-checked-hovered.png
  9832. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-checked-pressed.png
  9833. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-checked.png
  9834. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-disabled.png
  9835. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-focused.png
  9836. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-hovered.png
  9837. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-partially-checked-focused.png
  9838. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-partially-checked-hovered.png
  9839. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-partially-checked-pressed.png
  9840. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-partially-checked.png
  9841. share/doc/qt5/qtquickcontrols/images/checkbox-indicator-pressed.png
  9842. share/doc/qt5/qtquickcontrols/images/checkbox-indicator.png
  9843. share/doc/qt5/qtquickcontrols/images/checkdelegate-background-disabled.9.png
  9844. share/doc/qt5/qtquickcontrols/images/checkdelegate-background-focused.9.png
  9845. share/doc/qt5/qtquickcontrols/images/checkdelegate-background-hovered.9.png
  9846. share/doc/qt5/qtquickcontrols/images/checkdelegate-background-pressed.9.png
  9847. share/doc/qt5/qtquickcontrols/images/checkdelegate-background.9.png
  9848. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-checked-focused.png
  9849. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-checked-hovered.png
  9850. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-checked-pressed.png
  9851. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-checked.png
  9852. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-disabled.png
  9853. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-focused.png
  9854. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-hovered.png
  9855. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-partially-checked-focused.png
  9856. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-partially-checked-hovered.png
  9857. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-partially-checked-pressed.png
  9858. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-partially-checked.png
  9859. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator-pressed.png
  9860. share/doc/qt5/qtquickcontrols/images/checkdelegate-indicator.png
  9861. share/doc/qt5/qtquickcontrols/images/combobox-background-disabled.9.png
  9862. share/doc/qt5/qtquickcontrols/images/combobox-background-editable-disabled.9.png
  9863. share/doc/qt5/qtquickcontrols/images/combobox-background-editable-focused.9.png
  9864. share/doc/qt5/qtquickcontrols/images/combobox-background-editable.9.png
  9865. share/doc/qt5/qtquickcontrols/images/combobox-background-focused.9.png
  9866. share/doc/qt5/qtquickcontrols/images/combobox-background-hovered.9.png
  9867. share/doc/qt5/qtquickcontrols/images/combobox-background-open.9.png
  9868. share/doc/qt5/qtquickcontrols/images/combobox-background-pressed.9.png
  9869. share/doc/qt5/qtquickcontrols/images/combobox-background.9.png
  9870. share/doc/qt5/qtquickcontrols/images/combobox-indicator-disabled.png
  9871. share/doc/qt5/qtquickcontrols/images/combobox-indicator-editable-disabled.png
  9872. share/doc/qt5/qtquickcontrols/images/combobox-indicator-editable-mirrored-disabled.png
  9873. share/doc/qt5/qtquickcontrols/images/combobox-indicator-editable-mirrored.png
  9874. share/doc/qt5/qtquickcontrols/images/combobox-indicator-editable.png
  9875. share/doc/qt5/qtquickcontrols/images/combobox-indicator.png
  9876. share/doc/qt5/qtquickcontrols/images/combobox-popup.9.png
  9877. share/doc/qt5/qtquickcontrols/images/delaybutton-background-checked-focused.9.png
  9878. share/doc/qt5/qtquickcontrols/images/delaybutton-background-checked-hovered.9.png
  9879. share/doc/qt5/qtquickcontrols/images/delaybutton-background-checked.9.png
  9880. share/doc/qt5/qtquickcontrols/images/delaybutton-background-disabled-checked.9.png
  9881. share/doc/qt5/qtquickcontrols/images/delaybutton-background-disabled.9.png
  9882. share/doc/qt5/qtquickcontrols/images/delaybutton-background-focused.9.png
  9883. share/doc/qt5/qtquickcontrols/images/delaybutton-background-hovered.9.png
  9884. share/doc/qt5/qtquickcontrols/images/delaybutton-background-pressed.9.png
  9885. share/doc/qt5/qtquickcontrols/images/delaybutton-background.9.png
  9886. share/doc/qt5/qtquickcontrols/images/delaybutton-mask.9.png
  9887. share/doc/qt5/qtquickcontrols/images/delaybutton-progress-disabled.9.png
  9888. share/doc/qt5/qtquickcontrols/images/delaybutton-progress.9.png
  9889. share/doc/qt5/qtquickcontrols/images/dial-background-disabled.png
  9890. share/doc/qt5/qtquickcontrols/images/dial-background-focused.png
  9891. share/doc/qt5/qtquickcontrols/images/dial-background.png
  9892. share/doc/qt5/qtquickcontrols/images/dial-handle-disabled.png
  9893. share/doc/qt5/qtquickcontrols/images/dial-handle-focused-hovered.png
  9894. share/doc/qt5/qtquickcontrols/images/dial-handle-focused-pressed.png
  9895. share/doc/qt5/qtquickcontrols/images/dial-handle-focused.png
  9896. share/doc/qt5/qtquickcontrols/images/dial-handle-hovered.png
  9897. share/doc/qt5/qtquickcontrols/images/dial-handle-pressed.png
  9898. share/doc/qt5/qtquickcontrols/images/dial-handle.png
  9899. share/doc/qt5/qtquickcontrols/images/dialog-background.9.png
  9900. share/doc/qt5/qtquickcontrols/images/dialog-overlay-modal.png
  9901. share/doc/qt5/qtquickcontrols/images/dialog-overlay.png
  9902. share/doc/qt5/qtquickcontrols/images/dialogbuttonbox-background.9.png
  9903. share/doc/qt5/qtquickcontrols/images/drawer-background-bottom.9.png
  9904. share/doc/qt5/qtquickcontrols/images/drawer-background-left.9.png
  9905. share/doc/qt5/qtquickcontrols/images/drawer-background-right.9.png
  9906. share/doc/qt5/qtquickcontrols/images/drawer-background-top.9.png
  9907. share/doc/qt5/qtquickcontrols/images/drawer-overlay-modal.png
  9908. share/doc/qt5/qtquickcontrols/images/drawer-overlay.png
  9909. share/doc/qt5/qtquickcontrols/images/frame-background.9.png
  9910. share/doc/qt5/qtquickcontrols/images/groupbox-background.9.png
  9911. share/doc/qt5/qtquickcontrols/images/groupbox-title.9.png
  9912. share/doc/qt5/qtquickcontrols/images/home.png
  9913. share/doc/qt5/qtquickcontrols/images/ico_note.png
  9914. share/doc/qt5/qtquickcontrols/images/ico_note_attention.png
  9915. share/doc/qt5/qtquickcontrols/images/ico_out.png
  9916. share/doc/qt5/qtquickcontrols/images/itemdelegate-background-disabled.9.png
  9917. share/doc/qt5/qtquickcontrols/images/itemdelegate-background-focused.9.png
  9918. share/doc/qt5/qtquickcontrols/images/itemdelegate-background-highlighted.9.png
  9919. share/doc/qt5/qtquickcontrols/images/itemdelegate-background-hovered.9.png
  9920. share/doc/qt5/qtquickcontrols/images/itemdelegate-background-pressed.9.png
  9921. share/doc/qt5/qtquickcontrols/images/itemdelegate-background.9.png
  9922. share/doc/qt5/qtquickcontrols/images/logo.png
  9923. share/doc/qt5/qtquickcontrols/images/menu-background.9.png
  9924. share/doc/qt5/qtquickcontrols/images/menuitem-arrow-disabled.png
  9925. share/doc/qt5/qtquickcontrols/images/menuitem-arrow-mirrored-disabled.png
  9926. share/doc/qt5/qtquickcontrols/images/menuitem-arrow-mirrored.png
  9927. share/doc/qt5/qtquickcontrols/images/menuitem-arrow.png
  9928. share/doc/qt5/qtquickcontrols/images/menuitem-background-highlighted.9.png
  9929. share/doc/qt5/qtquickcontrols/images/menuitem-background.9.png
  9930. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-checked-focused.png
  9931. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-checked-hovered.png
  9932. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-checked-pressed.png
  9933. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-checked.png
  9934. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-disabled.png
  9935. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-focused.png
  9936. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-hovered.png
  9937. share/doc/qt5/qtquickcontrols/images/menuitem-indicator-pressed.png
  9938. share/doc/qt5/qtquickcontrols/images/menuitem-indicator.png
  9939. share/doc/qt5/qtquickcontrols/images/menuseparator-separator.9.png
  9940. share/doc/qt5/qtquickcontrols/images/page-background.png
  9941. share/doc/qt5/qtquickcontrols/images/pageindicator-delegate-current.png
  9942. share/doc/qt5/qtquickcontrols/images/pageindicator-delegate-disabled-current.png
  9943. share/doc/qt5/qtquickcontrols/images/pageindicator-delegate-disabled.png
  9944. share/doc/qt5/qtquickcontrols/images/pageindicator-delegate-pressed.png
  9945. share/doc/qt5/qtquickcontrols/images/pageindicator-delegate.png
  9946. share/doc/qt5/qtquickcontrols/images/pane-background.9.png
  9947. share/doc/qt5/qtquickcontrols/images/popup-background.9.png
  9948. share/doc/qt5/qtquickcontrols/images/popup-overlay-modal.png
  9949. share/doc/qt5/qtquickcontrols/images/popup-overlay.png
  9950. share/doc/qt5/qtquickcontrols/images/progressbar-background.9.png
  9951. share/doc/qt5/qtquickcontrols/images/progressbar-mask.9.png
  9952. share/doc/qt5/qtquickcontrols/images/progressbar-progress.png
  9953. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-applicationwindow-wireframe.png
  9954. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-automotive.png
  9955. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-busyindicator-custom.png
  9956. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-busyindicator.gif
  9957. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-busyindicator.png
  9958. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-custom.png
  9959. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-flat.gif
  9960. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-highlighted.gif
  9961. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-icononly.png
  9962. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-textbesideicon.png
  9963. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-textonly.png
  9964. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button-textundericon.png
  9965. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-button.gif
  9966. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter1.png
  9967. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2-listview-header.gif
  9968. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2.png
  9969. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-listview-header.gif
  9970. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-view-margins.png
  9971. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3.gif
  9972. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-long-message.png
  9973. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
  9974. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4.gif
  9975. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
  9976. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
  9977. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material.png
  9978. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
  9979. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
  9980. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
  9981. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
  9982. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material.png
  9983. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
  9984. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
  9985. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkbox-custom.png
  9986. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkbox-group.png
  9987. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkbox-tristate.gif
  9988. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkbox.gif
  9989. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkdelegate-custom.png
  9990. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkdelegate-tristate.gif
  9991. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-checkdelegate.gif
  9992. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-combobox-custom.png
  9993. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-combobox.gif
  9994. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-contactlist.png
  9995. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-control.png
  9996. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-customize-buttons.png
  9997. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-default-thumbnail.png
  9998. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-default.png
  9999. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-delaybutton-custom.png
  10000. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-delaybutton.gif
  10001. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dial-custom.png
  10002. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dial-inputmode.png
  10003. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dial-no-wrap.gif
  10004. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dial-wrap.gif
  10005. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dial.png
  10006. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-dialogbuttonbox.png
  10007. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-drawer-expanded-wireframe.png
  10008. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-drawer.gif
  10009. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-flatstyle-creator.png
  10010. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-flatstyle.png
  10011. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-frame-custom.png
  10012. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-frame.png
  10013. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-fusion-palettes.png
  10014. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-fusion-thumbnail.png
  10015. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-fusion-violet.png
  10016. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-fusion.png
  10017. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-gallery-drawer.png
  10018. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-gallery-menu.png
  10019. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-gallery-welcome.png
  10020. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-groupbox-checkable.png
  10021. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-groupbox-custom.png
  10022. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-groupbox.png
  10023. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-4x.png
  10024. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset-boundaries.png
  10025. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset.png
  10026. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-padding.png
  10027. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-stretchable.png
  10028. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-size.png
  10029. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-customization-dark.png
  10030. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine-thumbnail.png
  10031. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-imagine.png
  10032. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-itemdelegate-custom.png
  10033. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-itemdelegate.gif
  10034. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-label-custom.png
  10035. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-label.png
  10036. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-accent.png
  10037. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-attributes.png
  10038. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-background.png
  10039. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-dark.png
  10040. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-elevation.png
  10041. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-foreground.png
  10042. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-light.png
  10043. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-purple.png
  10044. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-theme.png
  10045. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-thumbnail.png
  10046. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-variant-dense.png
  10047. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-material-variant-normal.png
  10048. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-menu-custom.png
  10049. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-menu.png
  10050. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-menubar-custom.png
  10051. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-menubar.png
  10052. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-menuseparator.png
  10053. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-musicplayer.png
  10054. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-page-wireframe.png
  10055. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-pageindicator-custom.png
  10056. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-pageindicator.png
  10057. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-pane-custom.png
  10058. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-pane.png
  10059. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-popup-custom.png
  10060. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-popup-settings.png
  10061. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-popup-transformorigin.png
  10062. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-popup.png
  10063. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-progressbar-custom.png
  10064. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-progressbar-indeterminate.gif
  10065. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-progressbar.gif
  10066. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-radiobutton-custom.png
  10067. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-radiobutton.gif
  10068. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-radiodelegate-custom.png
  10069. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-radiodelegate.gif
  10070. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-rangeslider-custom.png
  10071. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-rangeslider.gif
  10072. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-roundbutton.png
  10073. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar-custom.png
  10074. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar-non-attached.png
  10075. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar-nosnap.gif
  10076. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar-snapalways.gif
  10077. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar-snaponrelease.gif
  10078. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollbar.gif
  10079. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollindicator-custom.png
  10080. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollindicator-non-attached.png
  10081. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollindicator.gif
  10082. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollview-custom.png
  10083. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollview-wireframe.png
  10084. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-scrollview.png
  10085. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-sidepanel-landscape.png
  10086. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-sidepanel-portrait.png
  10087. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-slider-custom.png
  10088. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-slider-nosnap.gif
  10089. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-slider-snapalways.gif
  10090. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-slider-snaponrelease.gif
  10091. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-slider.gif
  10092. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-spinbox-custom.png
  10093. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-spinbox-double.png
  10094. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-spinbox-textual.png
  10095. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-spinbox.png
  10096. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-pop.gif
  10097. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-push.gif
  10098. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-replace.gif
  10099. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-unwind.gif
  10100. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-visible.png
  10101. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-stackview-wireframe.png
  10102. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-styles.png
  10103. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipedelegate-behind.gif
  10104. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipedelegate-custom.png
  10105. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
  10106. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipedelegate.gif
  10107. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipetoremove.png
  10108. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipeview-wireframe.png
  10109. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-swipeview.gif
  10110. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-switch-custom.png
  10111. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-switch.gif
  10112. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-switch.png
  10113. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-switchdelegate-custom.png
  10114. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-switchdelegate.gif
  10115. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tabbar-custom.png
  10116. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tabbar-explicit.png
  10117. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tabbar-flickable.png
  10118. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tabbar-wireframe.png
  10119. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tabbutton.png
  10120. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textarea-custom.png
  10121. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textarea-scrollable.png
  10122. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textarea.png
  10123. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-texteditor-desktop.jpg
  10124. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-texteditor-touch.jpg
  10125. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textfield-custom.png
  10126. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textfield-disabled.png
  10127. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textfield-focused.png
  10128. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textfield-normal.png
  10129. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-textfield.png
  10130. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolbar-custom.png
  10131. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolbar.png
  10132. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolbutton-custom.png
  10133. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolbutton.png
  10134. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolseparator-custom.png
  10135. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-toolseparator.png
  10136. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tooltip-slider.png
  10137. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tooltip.png
  10138. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tumbler-custom.png
  10139. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tumbler-wrap.gif
  10140. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-tumbler.png
  10141. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-accent.png
  10142. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-attributes.png
  10143. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-background.png
  10144. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-dark.png
  10145. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-foreground.png
  10146. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-light.png
  10147. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-theme.png
  10148. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-thumbnail.png
  10149. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-universal-violet.png
  10150. share/doc/qt5/qtquickcontrols/images/qtquickcontrols2-wearable.png
  10151. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-checked-focused.png
  10152. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-checked-hovered.png
  10153. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-checked-pressed.png
  10154. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-checked.png
  10155. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-disabled.png
  10156. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-focused.png
  10157. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-hovered.png
  10158. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator-pressed.png
  10159. share/doc/qt5/qtquickcontrols/images/radiobutton-indicator.png
  10160. share/doc/qt5/qtquickcontrols/images/radiodelegate-background-disabled.9.png
  10161. share/doc/qt5/qtquickcontrols/images/radiodelegate-background-focused.9.png
  10162. share/doc/qt5/qtquickcontrols/images/radiodelegate-background-hovered.9.png
  10163. share/doc/qt5/qtquickcontrols/images/radiodelegate-background-pressed.9.png
  10164. share/doc/qt5/qtquickcontrols/images/radiodelegate-background.9.png
  10165. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-checked-focused.png
  10166. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-checked-hovered.png
  10167. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-checked-pressed.png
  10168. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-checked.png
  10169. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-disabled.png
  10170. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-focused.png
  10171. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-hovered.png
  10172. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator-pressed.png
  10173. share/doc/qt5/qtquickcontrols/images/radiodelegate-indicator.png
  10174. share/doc/qt5/qtquickcontrols/images/rangeslider-background-horizontal.9.png
  10175. share/doc/qt5/qtquickcontrols/images/rangeslider-background-vertical.9.png
  10176. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-disabled.png
  10177. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-focused-hovered.png
  10178. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-focused-pressed.png
  10179. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-focused.png
  10180. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-hovered.png
  10181. share/doc/qt5/qtquickcontrols/images/rangeslider-handle-pressed.png
  10182. share/doc/qt5/qtquickcontrols/images/rangeslider-handle.png
  10183. share/doc/qt5/qtquickcontrols/images/rangeslider-progress-horizontal-disabled.9.png
  10184. share/doc/qt5/qtquickcontrols/images/rangeslider-progress-horizontal.9.png
  10185. share/doc/qt5/qtquickcontrols/images/rangeslider-progress-vertical-disabled.9.png
  10186. share/doc/qt5/qtquickcontrols/images/rangeslider-progress-vertical.9.png
  10187. share/doc/qt5/qtquickcontrols/images/roundbutton-background-checked-focused.png
  10188. share/doc/qt5/qtquickcontrols/images/roundbutton-background-checked-hovered.png
  10189. share/doc/qt5/qtquickcontrols/images/roundbutton-background-checked.png
  10190. share/doc/qt5/qtquickcontrols/images/roundbutton-background-disabled-checked.png
  10191. share/doc/qt5/qtquickcontrols/images/roundbutton-background-disabled.png
  10192. share/doc/qt5/qtquickcontrols/images/roundbutton-background-focused.png
  10193. share/doc/qt5/qtquickcontrols/images/roundbutton-background-highlighted-focused.png
  10194. share/doc/qt5/qtquickcontrols/images/roundbutton-background-highlighted-hovered.png
  10195. share/doc/qt5/qtquickcontrols/images/roundbutton-background-highlighted-pressed.png
  10196. share/doc/qt5/qtquickcontrols/images/roundbutton-background-highlighted.png
  10197. share/doc/qt5/qtquickcontrols/images/roundbutton-background-hovered.png
  10198. share/doc/qt5/qtquickcontrols/images/roundbutton-background-pressed.png
  10199. share/doc/qt5/qtquickcontrols/images/roundbutton-background.png
  10200. share/doc/qt5/qtquickcontrols/images/scrollbar-handle-disabled.png
  10201. share/doc/qt5/qtquickcontrols/images/scrollbar-handle-interactive-disabled.png
  10202. share/doc/qt5/qtquickcontrols/images/scrollbar-handle-interactive-hovered.png
  10203. share/doc/qt5/qtquickcontrols/images/scrollbar-handle-interactive-pressed.png
  10204. share/doc/qt5/qtquickcontrols/images/scrollbar-handle-interactive.png
  10205. share/doc/qt5/qtquickcontrols/images/scrollbar-handle.png
  10206. share/doc/qt5/qtquickcontrols/images/scrollindicator-handle.png
  10207. share/doc/qt5/qtquickcontrols/images/slider-background-horizontal.9.png
  10208. share/doc/qt5/qtquickcontrols/images/slider-background-vertical.9.png
  10209. share/doc/qt5/qtquickcontrols/images/slider-handle-disabled.png
  10210. share/doc/qt5/qtquickcontrols/images/slider-handle-focused-hovered.png
  10211. share/doc/qt5/qtquickcontrols/images/slider-handle-focused-pressed.png
  10212. share/doc/qt5/qtquickcontrols/images/slider-handle-focused.png
  10213. share/doc/qt5/qtquickcontrols/images/slider-handle-hovered.png
  10214. share/doc/qt5/qtquickcontrols/images/slider-handle-pressed.png
  10215. share/doc/qt5/qtquickcontrols/images/slider-handle.png
  10216. share/doc/qt5/qtquickcontrols/images/slider-progress-horizontal-disabled.9.png
  10217. share/doc/qt5/qtquickcontrols/images/slider-progress-horizontal.9.png
  10218. share/doc/qt5/qtquickcontrols/images/slider-progress-vertical-disabled.9.png
  10219. share/doc/qt5/qtquickcontrols/images/slider-progress-vertical.9.png
  10220. share/doc/qt5/qtquickcontrols/images/spinbox-background-disabled.9.png
  10221. share/doc/qt5/qtquickcontrols/images/spinbox-background-editable.9.png
  10222. share/doc/qt5/qtquickcontrols/images/spinbox-background-focused.9.png
  10223. share/doc/qt5/qtquickcontrols/images/spinbox-background.9.png
  10224. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-disabled.9.png
  10225. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-editable-focused.9.png
  10226. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-editable-hovered.9.png
  10227. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-editable-mirrored.9.png
  10228. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-editable-pressed.9.png
  10229. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-editable.9.png
  10230. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-focused.9.png
  10231. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-hovered.9.png
  10232. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-mirrored.9.png
  10233. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down-pressed.9.png
  10234. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-down.9.png
  10235. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-disabled.9.png
  10236. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-editable-focused.9.png
  10237. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-editable-hovered.9.png
  10238. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-editable-mirrored.9.png
  10239. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-editable-pressed.9.png
  10240. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-editable.9.png
  10241. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-focused.9.png
  10242. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-hovered.9.png
  10243. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-mirrored.9.png
  10244. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up-pressed.9.png
  10245. share/doc/qt5/qtquickcontrols/images/spinbox-indicator-up.9.png
  10246. share/doc/qt5/qtquickcontrols/images/swipedelegate-background-disabled.9.png
  10247. share/doc/qt5/qtquickcontrols/images/swipedelegate-background-focused.9.png
  10248. share/doc/qt5/qtquickcontrols/images/swipedelegate-background-hovered.9.png
  10249. share/doc/qt5/qtquickcontrols/images/swipedelegate-background-pressed.9.png
  10250. share/doc/qt5/qtquickcontrols/images/swipedelegate-background.9.png
  10251. share/doc/qt5/qtquickcontrols/images/switch-handle-disabled.png
  10252. share/doc/qt5/qtquickcontrols/images/switch-handle-pressed.png
  10253. share/doc/qt5/qtquickcontrols/images/switch-handle.png
  10254. share/doc/qt5/qtquickcontrols/images/switch-indicator-checked-focused.png
  10255. share/doc/qt5/qtquickcontrols/images/switch-indicator-checked-hovered.png
  10256. share/doc/qt5/qtquickcontrols/images/switch-indicator-checked-pressed.png
  10257. share/doc/qt5/qtquickcontrols/images/switch-indicator-checked.png
  10258. share/doc/qt5/qtquickcontrols/images/switch-indicator-disabled.png
  10259. share/doc/qt5/qtquickcontrols/images/switch-indicator-focused.png
  10260. share/doc/qt5/qtquickcontrols/images/switch-indicator-hovered.png
  10261. share/doc/qt5/qtquickcontrols/images/switch-indicator-pressed.png
  10262. share/doc/qt5/qtquickcontrols/images/switch-indicator.png
  10263. share/doc/qt5/qtquickcontrols/images/switchdelegate-background-disabled.9.png
  10264. share/doc/qt5/qtquickcontrols/images/switchdelegate-background-focused.9.png
  10265. share/doc/qt5/qtquickcontrols/images/switchdelegate-background-hovered.9.png
  10266. share/doc/qt5/qtquickcontrols/images/switchdelegate-background-pressed.9.png
  10267. share/doc/qt5/qtquickcontrols/images/switchdelegate-background.9.png
  10268. share/doc/qt5/qtquickcontrols/images/switchdelegate-handle-disabled.png
  10269. share/doc/qt5/qtquickcontrols/images/switchdelegate-handle.png
  10270. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-checked-focused.png
  10271. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-checked-hovered.png
  10272. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-checked-pressed.png
  10273. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-checked.png
  10274. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-disabled.png
  10275. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-focused.png
  10276. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-hovered.png
  10277. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator-pressed.png
  10278. share/doc/qt5/qtquickcontrols/images/switchdelegate-indicator.png
  10279. share/doc/qt5/qtquickcontrols/images/tabbar-background.png
  10280. share/doc/qt5/qtquickcontrols/images/tabbutton-background-checked.9.png
  10281. share/doc/qt5/qtquickcontrols/images/tabbutton-background-disabled-checked.9.png
  10282. share/doc/qt5/qtquickcontrols/images/tabbutton-background-disabled.9.png
  10283. share/doc/qt5/qtquickcontrols/images/tabbutton-background-hovered.9.png
  10284. share/doc/qt5/qtquickcontrols/images/tabbutton-background-pressed.9.png
  10285. share/doc/qt5/qtquickcontrols/images/tabbutton-background.9.png
  10286. share/doc/qt5/qtquickcontrols/images/textarea-background-disabled.9.png
  10287. share/doc/qt5/qtquickcontrols/images/textarea-background-focused.9.png
  10288. share/doc/qt5/qtquickcontrols/images/textarea-background.9.png
  10289. share/doc/qt5/qtquickcontrols/images/textfield-background-disabled.9.png
  10290. share/doc/qt5/qtquickcontrols/images/textfield-background-focused.9.png
  10291. share/doc/qt5/qtquickcontrols/images/textfield-background.9.png
  10292. share/doc/qt5/qtquickcontrols/images/toolbar-background.png
  10293. share/doc/qt5/qtquickcontrols/images/toolbutton-background-checked-focused.9.png
  10294. share/doc/qt5/qtquickcontrols/images/toolbutton-background-checked-hovered.9.png
  10295. share/doc/qt5/qtquickcontrols/images/toolbutton-background-checked.9.png
  10296. share/doc/qt5/qtquickcontrols/images/toolbutton-background-disabled-checked.9.png
  10297. share/doc/qt5/qtquickcontrols/images/toolbutton-background-focused.9.png
  10298. share/doc/qt5/qtquickcontrols/images/toolbutton-background-hovered.9.png
  10299. share/doc/qt5/qtquickcontrols/images/toolbutton-background-pressed.9.png
  10300. share/doc/qt5/qtquickcontrols/images/toolbutton-background.9.png
  10301. share/doc/qt5/qtquickcontrols/images/toolseparator-separator-horizontal.9.png
  10302. share/doc/qt5/qtquickcontrols/images/toolseparator-separator-vertical.9.png
  10303. share/doc/qt5/qtquickcontrols/images/tooltip-background.9.png
  10304. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein.png
  10305. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@2x.png
  10306. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@3x.png
  10307. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Albert_Einstein@4x.png
  10308. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway.png
  10309. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@2x.png
  10310. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@3x.png
  10311. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Ernest_Hemingway@4x.png
  10312. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude.png
  10313. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@2x.png
  10314. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@3x.png
  10315. share/doc/qt5/qtquickcontrols/images/used-in-examples/chattutorial/shared/Hans_Gude@4x.png
  10316. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/back.png
  10317. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/drawer.png
  10318. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20/menu.png
  10319. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/back.png
  10320. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/drawer.png
  10321. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@2/menu.png
  10322. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/back.png
  10323. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/drawer.png
  10324. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@3/menu.png
  10325. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/back.png
  10326. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/drawer.png
  10327. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/icons/gallery/20x20@4/menu.png
  10328. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrow.png
  10329. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrow@2x.png
  10330. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrow@3x.png
  10331. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrow@4x.png
  10332. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrows.png
  10333. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrows@2x.png
  10334. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrows@3x.png
  10335. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/arrows@4x.png
  10336. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo.png
  10337. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@2x.png
  10338. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@3x.png
  10339. share/doc/qt5/qtquickcontrols/images/used-in-examples/gallery/images/qt-logo@4x.png
  10340. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/air-con.png
  10341. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/command.png
  10342. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/message.png
  10343. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/music.png
  10344. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/seats.png
  10345. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/settings.png
  10346. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/statistics.png
  10347. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44/windows.png
  10348. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/air-con.png
  10349. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/command.png
  10350. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/message.png
  10351. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/music.png
  10352. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/navigation.png
  10353. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/seats.png
  10354. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/settings.png
  10355. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/statistics.png
  10356. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/automotive/44x44@2/windows.png
  10357. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/car.png
  10358. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/car@2x.png
  10359. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/warning.png
  10360. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/warning@2x.png
  10361. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/weather.png
  10362. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/icons/weather@2x.png
  10363. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/applicationwindow-background.png
  10364. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/applicationwindow-background@2x.png
  10365. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked-hovered.9.png
  10366. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked-hovered@2x.9.png
  10367. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked.9.png
  10368. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-checked@2x.9.png
  10369. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-hovered.9.png
  10370. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-hovered@2x.9.png
  10371. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-pressed.9.png
  10372. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background-pressed@2x.9.png
  10373. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background.9.png
  10374. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/button-background@2x.9.png
  10375. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-hovered.png
  10376. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-hovered@2x.png
  10377. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-pressed.png
  10378. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background-pressed@2x.png
  10379. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background.png
  10380. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-background@2x.png
  10381. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle-pressed.png
  10382. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle-pressed@2x.png
  10383. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle.png
  10384. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/dial-handle@2x.png
  10385. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/frame-background.9.png
  10386. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/frame-background@2x.9.png
  10387. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-checked.9.png
  10388. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-checked@2x.9.png
  10389. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-hovered.9.png
  10390. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-hovered@2x.9.png
  10391. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-pressed.9.png
  10392. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background-pressed@2x.9.png
  10393. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background.9.png
  10394. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/itemdelegate-background@2x.9.png
  10395. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-hovered.png
  10396. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-hovered@2x.png
  10397. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-pressed.png
  10398. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked-pressed@2x.png
  10399. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked.png
  10400. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-checked@2x.png
  10401. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-hovered.png
  10402. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-hovered@2x.png
  10403. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-pressed.png
  10404. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator-pressed@2x.png
  10405. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator.png
  10406. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/radiobutton-indicator@2x.png
  10407. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/scrollindicator-handle.png
  10408. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/scrollindicator-handle@2x.png
  10409. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-background-horizontal.9.png
  10410. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-background-horizontal@2x.9.png
  10411. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-hovered.png
  10412. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-hovered@2x.png
  10413. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-pressed.png
  10414. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle-pressed@2x.png
  10415. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle.png
  10416. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-handle@2x.png
  10417. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal-pressed.9.png
  10418. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal-pressed@2x.9.png
  10419. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal.9.png
  10420. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/slider-progress-horizontal@2x.9.png
  10421. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-background.9.png
  10422. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-background@2x.9.png
  10423. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked-hovered.png
  10424. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked-hovered@2x.png
  10425. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked.png
  10426. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-checked@2x.png
  10427. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-hovered.png
  10428. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-hovered@2x.png
  10429. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-pressed.png
  10430. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle-pressed@2x.png
  10431. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle.png
  10432. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-handle@2x.png
  10433. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator-pressed.png
  10434. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator-pressed@2x.png
  10435. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator.png
  10436. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/switchdelegate-indicator@2x.png
  10437. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/toolseparator-separator-vertical.9.png
  10438. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/automotive/imagine-assets/toolseparator-separator-vertical@2x.9.png
  10439. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/bluetooth.png
  10440. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/cart.png
  10441. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/cloud.png
  10442. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/favorite.png
  10443. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/filter.png
  10444. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/folder.png
  10445. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/message.png
  10446. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/music.png
  10447. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/next.png
  10448. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/pause.png
  10449. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/power.png
  10450. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/previous.png
  10451. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/repeat.png
  10452. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/save.png
  10453. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/settings.png
  10454. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/shuffle.png
  10455. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32/stop.png
  10456. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/bluetooth.png
  10457. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/cart.png
  10458. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/cloud.png
  10459. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/favorite.png
  10460. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/filter.png
  10461. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/folder.png
  10462. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/grid.png
  10463. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/message.png
  10464. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/music.png
  10465. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/next.png
  10466. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/pause.png
  10467. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/power.png
  10468. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/previous.png
  10469. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/repeat.png
  10470. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/save.png
  10471. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/settings.png
  10472. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/shuffle.png
  10473. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/icons/musicplayer/32x32@2/stop.png
  10474. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/images/album-cover.jpg
  10475. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/applicationwindow-background.png
  10476. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked-hovered.9.png
  10477. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked-hovered@2x.9.png
  10478. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked.9.png
  10479. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-checked@2x.9.png
  10480. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-disabled.9.png
  10481. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-disabled@2x.9.png
  10482. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-hovered.9.png
  10483. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-hovered@2x.9.png
  10484. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-pressed.9.png
  10485. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background-pressed@2x.9.png
  10486. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background.9.png
  10487. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/button-background@2x.9.png
  10488. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-hovered.9.png
  10489. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-hovered@2x.9.png
  10490. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-open.9.png
  10491. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-open@2x.9.png
  10492. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-pressed.9.png
  10493. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background-pressed@2x.9.png
  10494. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background.9.png
  10495. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-background@2x.9.png
  10496. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-hovered.png
  10497. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-hovered@2x.png
  10498. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-open.png
  10499. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-open@2x.png
  10500. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-pressed.png
  10501. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator-pressed@2x.png
  10502. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator.png
  10503. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-indicator@2x.png
  10504. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-popup.9.png
  10505. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/combobox-popup@2x.9.png
  10506. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-hovered.png
  10507. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-hovered@2x.png
  10508. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-pressed.png
  10509. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background-pressed@2x.png
  10510. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background.png
  10511. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-background@2x.png
  10512. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle-pressed.png
  10513. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle-pressed@2x.png
  10514. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle.png
  10515. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/dial-handle@2x.png
  10516. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/frame-background.9.png
  10517. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/frame-background@2x.9.png
  10518. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-checked.9.png
  10519. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-checked@2x.9.png
  10520. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-disabled.9.png
  10521. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-disabled@2x.9.png
  10522. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-hovered.9.png
  10523. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-hovered@2x.9.png
  10524. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-pressed.9.png
  10525. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background-pressed@2x.9.png
  10526. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background.9.png
  10527. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/itemdelegate-background@2x.9.png
  10528. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked-hovered.png
  10529. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked-hovered@2x.png
  10530. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked.png
  10531. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-checked@2x.png
  10532. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-disabled.png
  10533. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-disabled@2x.png
  10534. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-hovered.png
  10535. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-hovered@2x.png
  10536. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-pressed.png
  10537. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background-pressed@2x.png
  10538. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background.png
  10539. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/roundbutton-background@2x.png
  10540. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-hovered.png
  10541. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-hovered@2x.png
  10542. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-pressed.png
  10543. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive-pressed@2x.png
  10544. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive.png
  10545. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/scrollbar-handle-interactive@2x.png
  10546. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal-disabled.9.png
  10547. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal-disabled@2x.9.png
  10548. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal.9.png
  10549. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-horizontal@2x.9.png
  10550. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical-disabled.9.png
  10551. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical-disabled@2x.9.png
  10552. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical.9.png
  10553. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-background-vertical@2x.9.png
  10554. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-disabled.png
  10555. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-disabled@2x.png
  10556. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-hovered.png
  10557. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle-hovered@2x.png
  10558. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle.png
  10559. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-handle@2x.png
  10560. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-horizontal.9.png
  10561. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-horizontal@2x.9.png
  10562. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical-disabled.9.png
  10563. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical-disabled@2x.9.png
  10564. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical.9.png
  10565. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/slider-progress-vertical@2x.9.png
  10566. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background-disabled.9.png
  10567. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background-disabled@2x.9.png
  10568. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background.9.png
  10569. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/textfield-background@2x.9.png
  10570. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbar-background.9.png
  10571. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbar-background@2x.9.png
  10572. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked-hovered.9.png
  10573. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked-hovered@2x.9.png
  10574. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked.9.png
  10575. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-checked@2x.9.png
  10576. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-hovered.9.png
  10577. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-hovered@2x.9.png
  10578. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-pressed.9.png
  10579. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background-pressed@2x.9.png
  10580. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background.9.png
  10581. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/toolbutton-background@2x.9.png
  10582. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/tooltip-background.9.png
  10583. share/doc/qt5/qtquickcontrols/images/used-in-examples/imagine/musicplayer/imagine-assets/tooltip-background@2x.9.png
  10584. share/doc/qt5/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo.png
  10585. share/doc/qt5/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@2x.png
  10586. share/doc/qt5/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@3x.png
  10587. share/doc/qt5/qtquickcontrols/images/used-in-examples/sidepanel/images/qt-logo@4x.png
  10588. share/doc/qt5/qtquickcontrols/images/used-in-examples/texteditor/images/qt-logo.png
  10589. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/alarms.png
  10590. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/fitness.png
  10591. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/navigation.png
  10592. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/notifications.png
  10593. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/settings.png
  10594. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/weather.png
  10595. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36/worldclock.png
  10596. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/alarms.png
  10597. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/fitness.png
  10598. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/navigation.png
  10599. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/notifications.png
  10600. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/settings.png
  10601. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/weather.png
  10602. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/icons/wearable/36x36@2/worldclock.png
  10603. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/back.png
  10604. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/back@2x.png
  10605. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/back@3x.png
  10606. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/back@4x.png
  10607. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/background-dark.png
  10608. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/background-light.png
  10609. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/home.png
  10610. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/home@2x.png
  10611. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/home@3x.png
  10612. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/images/home@4x.png
  10613. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-dark.png
  10614. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-dark@2x.png
  10615. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-light.png
  10616. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-running-light@2x.png
  10617. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-dark.png
  10618. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-dark@2x.png
  10619. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-light.png
  10620. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Fitness/images/man-walking-light@2x.png
  10621. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/end.png
  10622. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/end@2x.png
  10623. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-dark.png
  10624. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-dark@2x.png
  10625. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-light.png
  10626. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/leftturn-light@2x.png
  10627. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/marker.png
  10628. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-dark.png
  10629. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-dark@2x.png
  10630. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-light.png
  10631. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/navigation-light@2x.png
  10632. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-dark.png
  10633. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-dark@2x.png
  10634. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-light.png
  10635. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/rightturn-light@2x.png
  10636. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/start.png
  10637. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/start@2x.png
  10638. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-dark.png
  10639. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-dark@2x.png
  10640. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-light.png
  10641. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/straight-light@2x.png
  10642. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/uturn.png
  10643. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Navigation/images/uturn@2x.png
  10644. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-dark.png
  10645. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-dark@2x.png
  10646. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-light.png
  10647. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarf-light@2x.png
  10648. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-dark.png
  10649. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-dark@2x.png
  10650. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-light.png
  10651. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/avatarm-light@2x.png
  10652. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-dark.png
  10653. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-dark@2x.png
  10654. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-light.png
  10655. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Notifications/images/missedcall-light@2x.png
  10656. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-dark.png
  10657. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-dark@2x.png
  10658. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-light.png
  10659. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/bluetooth-light@2x.png
  10660. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-dark.png
  10661. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-dark@2x.png
  10662. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-light.png
  10663. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/brightness-light@2x.png
  10664. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-dark.png
  10665. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-dark@2x.png
  10666. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-light.png
  10667. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-light@2x.png
  10668. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-white.png
  10669. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/demo-mode-white@2x.png
  10670. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-dark.png
  10671. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-dark@2x.png
  10672. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-light.png
  10673. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/theme-light@2x.png
  10674. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-dark.png
  10675. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-dark@2x.png
  10676. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-light.png
  10677. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Settings/images/wifi-light@2x.png
  10678. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-dark.png
  10679. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-dark@2x.png
  10680. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-light.png
  10681. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/humidity-light@2x.png
  10682. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-dark.png
  10683. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-dark@2x.png
  10684. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-light.png
  10685. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/pressure-light@2x.png
  10686. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-dark.png
  10687. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-dark@2x.png
  10688. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-light.png
  10689. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunrise-light@2x.png
  10690. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-dark.png
  10691. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-dark@2x.png
  10692. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-light.png
  10693. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/sunset-light@2x.png
  10694. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-dark.png
  10695. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-dark@2x.png
  10696. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-light.png
  10697. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/temperature-light@2x.png
  10698. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-dark.png
  10699. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-dark@2x.png
  10700. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-light.png
  10701. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/Weather/images/wind-light@2x.png
  10702. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/center.png
  10703. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/center@2x.png
  10704. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock-night.png
  10705. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock-night@2x.png
  10706. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/clock.png
  10707. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/second.png
  10708. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/second@2x.png
  10709. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial.png
  10710. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdaydial@2x.png
  10711. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour.png
  10712. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayhour@2x.png
  10713. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute.png
  10714. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissdayminute@2x.png
  10715. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial.png
  10716. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightdial@2x.png
  10717. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour.png
  10718. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnighthour@2x.png
  10719. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute.png
  10720. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissnightminute@2x.png
  10721. share/doc/qt5/qtquickcontrols/images/used-in-examples/wearable/qml/WorldClock/images/swissseconds.png
  10722. share/doc/qt5/qtquickcontrols/qml-palette.html
  10723. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-abstractbutton-members.html
  10724. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-abstractbutton.html
  10725. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-action-members.html
  10726. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-action.html
  10727. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-actiongroup-members.html
  10728. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-actiongroup.html
  10729. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-applicationwindow-members.html
  10730. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-applicationwindow-obsolete.html
  10731. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-applicationwindow.html
  10732. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-busyindicator-members.html
  10733. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-busyindicator.html
  10734. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-button-members.html
  10735. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-button.html
  10736. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-buttongroup-members.html
  10737. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-buttongroup.html
  10738. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-checkbox-members.html
  10739. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-checkbox.html
  10740. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-checkdelegate-members.html
  10741. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-checkdelegate.html
  10742. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-combobox-members.html
  10743. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-combobox.html
  10744. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-container-members.html
  10745. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-container-obsolete.html
  10746. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-container.html
  10747. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-control-members.html
  10748. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-control.html
  10749. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-delaybutton-members.html
  10750. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-delaybutton.html
  10751. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dial-members.html
  10752. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dial.html
  10753. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dialog-members.html
  10754. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dialog.html
  10755. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox-members.html
  10756. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox.html
  10757. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-drawer-members.html
  10758. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-drawer.html
  10759. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-frame-members.html
  10760. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-frame.html
  10761. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-groupbox-members.html
  10762. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-groupbox.html
  10763. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-itemdelegate-members.html
  10764. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-itemdelegate.html
  10765. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-label-members.html
  10766. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-label.html
  10767. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menu-members.html
  10768. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menu-obsolete.html
  10769. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menu.html
  10770. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menubar-members.html
  10771. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menubar.html
  10772. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menubaritem-members.html
  10773. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menubaritem.html
  10774. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menuitem-members.html
  10775. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menuitem.html
  10776. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menuseparator-members.html
  10777. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-menuseparator.html
  10778. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-overlay-members.html
  10779. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-overlay.html
  10780. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-page-members.html
  10781. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-page.html
  10782. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-pageindicator-members.html
  10783. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-pageindicator.html
  10784. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-pane-members.html
  10785. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-pane.html
  10786. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-popup-members.html
  10787. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-popup.html
  10788. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-progressbar-members.html
  10789. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-progressbar.html
  10790. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-radiobutton-members.html
  10791. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-radiobutton.html
  10792. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-radiodelegate-members.html
  10793. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-radiodelegate.html
  10794. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-rangeslider-members.html
  10795. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-rangeslider.html
  10796. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-roundbutton-members.html
  10797. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-roundbutton.html
  10798. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollbar-members.html
  10799. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollbar.html
  10800. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollindicator-members.html
  10801. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollindicator.html
  10802. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollview-members.html
  10803. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-scrollview.html
  10804. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-slider-members.html
  10805. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-slider.html
  10806. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-spinbox-members.html
  10807. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-spinbox.html
  10808. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-stackview-members.html
  10809. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-stackview.html
  10810. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-swipedelegate-members.html
  10811. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-swipedelegate.html
  10812. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-swipeview-members.html
  10813. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-swipeview.html
  10814. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-switch-members.html
  10815. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-switch.html
  10816. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-switchdelegate-members.html
  10817. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-switchdelegate.html
  10818. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tabbar-members.html
  10819. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tabbar.html
  10820. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tabbutton-members.html
  10821. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tabbutton.html
  10822. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-textarea-members.html
  10823. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-textarea.html
  10824. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-textfield-members.html
  10825. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-textfield.html
  10826. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolbar-members.html
  10827. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolbar.html
  10828. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolbutton-members.html
  10829. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolbutton.html
  10830. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolseparator-members.html
  10831. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-toolseparator.html
  10832. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tooltip-members.html
  10833. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tooltip.html
  10834. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tumbler-members.html
  10835. share/doc/qt5/qtquickcontrols/qml-qtquick-controls2-tumbler.html
  10836. share/doc/qt5/qtquickcontrols/qquickstyle-members.html
  10837. share/doc/qt5/qtquickcontrols/qquickstyle.html
  10838. share/doc/qt5/qtquickcontrols/qtquick-controls2-qmlmodule.html
  10839. share/doc/qt5/qtquickcontrols/qtquick-templates2-qmlmodule.html
  10840. share/doc/qt5/qtquickcontrols/qtquickcontrols-attribution-shadow-angular-material.html
  10841. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-chapter1-settingup-pro.html
  10842. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-main-cpp.html
  10843. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-main-qml.html
  10844. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter1-settingup-qml-qrc.html
  10845. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-chapter2-lists-pro.html
  10846. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-main-qml.html
  10847. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter2-lists-qml-qrc.html
  10848. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-chapter3-navigation-pro.html
  10849. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-contactpage-qml.html
  10850. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-conversationpage-qml.html
  10851. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-main-qml.html
  10852. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter3-navigation-qml-qrc.html
  10853. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-chapter4-models-pro.html
  10854. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-contactpage-qml.html
  10855. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-conversationpage-qml.html
  10856. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-main-qml.html
  10857. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-qml-qrc.html
  10858. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlcontactmodel-cpp.html
  10859. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlcontactmodel-h.html
  10860. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlconversationmodel-cpp.html
  10861. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter4-models-sqlconversationmodel-h.html
  10862. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-chapter5-styling-pro.html
  10863. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-chattoolbar-qml.html
  10864. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-contactpage-qml.html
  10865. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-conversationpage-qml.html
  10866. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-main-qml.html
  10867. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-material-chattoolbar-qml.html
  10868. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-qml-qrc.html
  10869. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-qtquickcontrols2-conf.html
  10870. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlcontactmodel-cpp.html
  10871. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlcontactmodel-h.html
  10872. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlconversationmodel-cpp.html
  10873. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chapter5-styling-sqlconversationmodel-h.html
  10874. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-chattutorial-pro.html
  10875. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-example.html
  10876. share/doc/qt5/qtquickcontrols/qtquickcontrols-chattutorial-shared-shared-qrc.html
  10877. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactdelegate-ui-qml.html
  10878. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactdialog-qml.html
  10879. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactform-ui-qml.html
  10880. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactlist-pro.html
  10881. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactlist-qml.html
  10882. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactmodel-cpp.html
  10883. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactmodel-h.html
  10884. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-contactview-ui-qml.html
  10885. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-designer-backend-contactmodel-qml.html
  10886. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-designer-backend-qmldir.html
  10887. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-example.html
  10888. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-main-cpp.html
  10889. share/doc/qt5/qtquickcontrols/qtquickcontrols-contactlist-sectiondelegate-ui-qml.html
  10890. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-example.html
  10891. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-flat-button-qml.html
  10892. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-flat-checkbox-qml.html
  10893. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-flat-switch-qml.html
  10894. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-flatstyle-pro.html
  10895. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-flatstyle-qml.html
  10896. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-imports-theme-qmldir.html
  10897. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-imports-theme-theme-qml.html
  10898. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-main-cpp.html
  10899. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-mainform-ui-qml.html
  10900. share/doc/qt5/qtquickcontrols/qtquickcontrols-flatstyle-qtquickcontrols2-conf.html
  10901. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-example.html
  10902. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-cpp.html
  10903. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-pro.html
  10904. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-gallery-qml.html
  10905. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-busyindicatorpage-qml.html
  10906. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-buttonpage-qml.html
  10907. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-checkboxpage-qml.html
  10908. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-comboboxpage-qml.html
  10909. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-delaybuttonpage-qml.html
  10910. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-delegatepage-qml.html
  10911. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-dialogpage-qml.html
  10912. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-dialpage-qml.html
  10913. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-framepage-qml.html
  10914. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-groupboxpage-qml.html
  10915. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-pageindicatorpage-qml.html
  10916. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-progressbarpage-qml.html
  10917. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-radiobuttonpage-qml.html
  10918. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-rangesliderpage-qml.html
  10919. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-scrollablepage-qml.html
  10920. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-scrollbarpage-qml.html
  10921. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-scrollindicatorpage-qml.html
  10922. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-sliderpage-qml.html
  10923. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-spinboxpage-qml.html
  10924. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-stackviewpage-qml.html
  10925. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-swipeviewpage-qml.html
  10926. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-switchpage-qml.html
  10927. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-tabbarpage-qml.html
  10928. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-textareapage-qml.html
  10929. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-textfieldpage-qml.html
  10930. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-tooltippage-qml.html
  10931. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-pages-tumblerpage-qml.html
  10932. share/doc/qt5/qtquickcontrols/qtquickcontrols-gallery-qtquickcontrols2-conf.html
  10933. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-automotive-cpp.html
  10934. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-automotive-pro.html
  10935. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-example.html
  10936. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-icons-automotive-icons-svg.html
  10937. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-icons-icons-qrc.html
  10938. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-imagine-assets-imagine-assets-qrc.html
  10939. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-automotive-qml.html
  10940. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-customglow-qml.html
  10941. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-featurebutton-qml.html
  10942. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-glowinglabel-qml.html
  10943. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qml-qml-qrc.html
  10944. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-automotive-qtquickcontrols2-conf.html
  10945. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-example.html
  10946. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-icons-icons-qrc.html
  10947. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-icons-musicplayer-icons-svg.html
  10948. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-imagine-assets-imagine-assets-qrc.html
  10949. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-cpp.html
  10950. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-pro.html
  10951. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-musicplayer-qml.html
  10952. share/doc/qt5/qtquickcontrols/qtquickcontrols-imagine-musicplayer-qtquickcontrols2-conf.html
  10953. share/doc/qt5/qtquickcontrols/qtquickcontrols-index.html
  10954. share/doc/qt5/qtquickcontrols/qtquickcontrols-sidepanel-example.html
  10955. share/doc/qt5/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-cpp.html
  10956. share/doc/qt5/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-pro.html
  10957. share/doc/qt5/qtquickcontrols/qtquickcontrols-sidepanel-sidepanel-qml.html
  10958. share/doc/qt5/qtquickcontrols/qtquickcontrols-swipetoremove-example.html
  10959. share/doc/qt5/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-cpp.html
  10960. share/doc/qt5/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-pro.html
  10961. share/doc/qt5/qtquickcontrols/qtquickcontrols-swipetoremove-swipetoremove-qml.html
  10962. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-documenthandler-cpp.html
  10963. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-documenthandler-h.html
  10964. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-example.html
  10965. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-texteditor-qml.html
  10966. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qml-touch-texteditor-qml.html
  10967. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-qtquickcontrols2-conf.html
  10968. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-texteditor-cpp.html
  10969. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-texteditor-pro.html
  10970. share/doc/qt5/qtquickcontrols/qtquickcontrols-texteditor-texteditor-qrc.html
  10971. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-example.html
  10972. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-alarms-alarmspage-qml.html
  10973. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-demomode-qml.html
  10974. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-demomodeindicator-qml.html
  10975. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-fitness-fitness-js.html
  10976. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-fitness-fitnesspage-qml.html
  10977. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-launcherpage-qml.html
  10978. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-navibutton-qml.html
  10979. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-navigation-js.html
  10980. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-navigationpage-qml.html
  10981. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-navigation-routeelement-qml.html
  10982. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-notifications-notifications-js.html
  10983. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-notifications-notificationspage-qml.html
  10984. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-settings-images-demo-mode-svg.html
  10985. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-settings-images-theme-svg.html
  10986. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-settings-settingspage-qml.html
  10987. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-style-pageindicator-qml.html
  10988. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-style-qmldir.html
  10989. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-style-slider-qml.html
  10990. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-style-switch-qml.html
  10991. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-style-uistyle-qml.html
  10992. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-swipeviewpage-qml.html
  10993. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-weather-weather-js.html
  10994. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-weather-weatherpage-qml.html
  10995. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-worldclock-clock-qml.html
  10996. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-qml-worldclock-worldclockpage-qml.html
  10997. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-wearable-cpp.html
  10998. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-wearable-pro.html
  10999. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-wearable-qml.html
  11000. share/doc/qt5/qtquickcontrols/qtquickcontrols-wearable-wearable-qrc.html
  11001. share/doc/qt5/qtquickcontrols/qtquickcontrols.index
  11002. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp
  11003. share/doc/qt5/qtquickcontrols/qtquickcontrols.qhp.sha1
  11004. share/doc/qt5/qtquickcontrols/qtquickcontrols.tags
  11005. share/doc/qt5/qtquickcontrols/qtquickcontrols2-buttons.html
  11006. share/doc/qt5/qtquickcontrols/qtquickcontrols2-configuration.html
  11007. share/doc/qt5/qtquickcontrols/qtquickcontrols2-containers.html
  11008. share/doc/qt5/qtquickcontrols/qtquickcontrols2-customize.html
  11009. share/doc/qt5/qtquickcontrols/qtquickcontrols2-default.html
  11010. share/doc/qt5/qtquickcontrols/qtquickcontrols2-delegates.html
  11011. share/doc/qt5/qtquickcontrols/qtquickcontrols2-deployment.html
  11012. share/doc/qt5/qtquickcontrols/qtquickcontrols2-differences.html
  11013. share/doc/qt5/qtquickcontrols/qtquickcontrols2-environment.html
  11014. share/doc/qt5/qtquickcontrols/qtquickcontrols2-examples.html
  11015. share/doc/qt5/qtquickcontrols/qtquickcontrols2-fileselectors.html
  11016. share/doc/qt5/qtquickcontrols/qtquickcontrols2-focus.html
  11017. share/doc/qt5/qtquickcontrols/qtquickcontrols2-fusion.html
  11018. share/doc/qt5/qtquickcontrols/qtquickcontrols2-gettingstarted.html
  11019. share/doc/qt5/qtquickcontrols/qtquickcontrols2-guidelines.html
  11020. share/doc/qt5/qtquickcontrols/qtquickcontrols2-highdpi.html
  11021. share/doc/qt5/qtquickcontrols/qtquickcontrols2-icons.html
  11022. share/doc/qt5/qtquickcontrols/qtquickcontrols2-imagine.html
  11023. share/doc/qt5/qtquickcontrols/qtquickcontrols2-indicators.html
  11024. share/doc/qt5/qtquickcontrols/qtquickcontrols2-input.html
  11025. share/doc/qt5/qtquickcontrols/qtquickcontrols2-material.html
  11026. share/doc/qt5/qtquickcontrols/qtquickcontrols2-menus.html
  11027. share/doc/qt5/qtquickcontrols/qtquickcontrols2-module.html
  11028. share/doc/qt5/qtquickcontrols/qtquickcontrols2-navigation.html
  11029. share/doc/qt5/qtquickcontrols/qtquickcontrols2-popups.html
  11030. share/doc/qt5/qtquickcontrols/qtquickcontrols2-separators.html
  11031. share/doc/qt5/qtquickcontrols/qtquickcontrols2-styles.html
  11032. share/doc/qt5/qtquickcontrols/qtquickcontrols2-universal.html
  11033. share/doc/qt5/qtquickcontrols/qtquicktemplates2-index.html
  11034. share/doc/qt5/qtquickcontrols/style/offline-simple.css
  11035. share/doc/qt5/qtquickcontrols/style/offline.css
  11036. share/doc/qt5/qtquickcontrols1.qch
  11037. share/doc/qt5/qtquickcontrols1/applicationwindow.html
  11038. share/doc/qt5/qtquickcontrols1/applicationwindowstyling.html
  11039. share/doc/qt5/qtquickcontrols1/controls.html
  11040. share/doc/qt5/qtquickcontrols1/controlsstyling.html
  11041. share/doc/qt5/qtquickcontrols1/examples-manifest.xml
  11042. share/doc/qt5/qtquickcontrols1/images/applicationwindow.png
  11043. share/doc/qt5/qtquickcontrols1/images/arrow_bc.png
  11044. share/doc/qt5/qtquickcontrols1/images/bgrContent.png
  11045. share/doc/qt5/qtquickcontrols1/images/btn_next.png
  11046. share/doc/qt5/qtquickcontrols1/images/btn_prev.png
  11047. share/doc/qt5/qtquickcontrols1/images/bullet_dn.png
  11048. share/doc/qt5/qtquickcontrols1/images/bullet_sq.png
  11049. share/doc/qt5/qtquickcontrols1/images/busyindicator.png
  11050. share/doc/qt5/qtquickcontrols1/images/button.png
  11051. share/doc/qt5/qtquickcontrols1/images/calendar.png
  11052. share/doc/qt5/qtquickcontrols1/images/calendarstyle-components-week-numbers.png
  11053. share/doc/qt5/qtquickcontrols1/images/checkbox.png
  11054. share/doc/qt5/qtquickcontrols1/images/circulargauge-angles.png
  11055. share/doc/qt5/qtquickcontrols1/images/circulargauge-needle-example-2.png
  11056. share/doc/qt5/qtquickcontrols1/images/circulargauge-needle.png
  11057. share/doc/qt5/qtquickcontrols1/images/circulargauge-reversed.png
  11058. share/doc/qt5/qtquickcontrols1/images/circulargauge-tickmark-indices-values.png
  11059. share/doc/qt5/qtquickcontrols1/images/combobox.png
  11060. share/doc/qt5/qtquickcontrols1/images/gauge-minorTickmark-example.png
  11061. share/doc/qt5/qtquickcontrols1/images/gauge-temperature.png
  11062. share/doc/qt5/qtquickcontrols1/images/gauge-tickmark-example.png
  11063. share/doc/qt5/qtquickcontrols1/images/groupbox.png
  11064. share/doc/qt5/qtquickcontrols1/images/home.png
  11065. share/doc/qt5/qtquickcontrols1/images/ico_note.png
  11066. share/doc/qt5/qtquickcontrols1/images/ico_note_attention.png
  11067. share/doc/qt5/qtquickcontrols1/images/ico_out.png
  11068. share/doc/qt5/qtquickcontrols1/images/label.png
  11069. share/doc/qt5/qtquickcontrols1/images/logo.png
  11070. share/doc/qt5/qtquickcontrols1/images/menu.png
  11071. share/doc/qt5/qtquickcontrols1/images/menubar-action.png
  11072. share/doc/qt5/qtquickcontrols1/images/menubar.png
  11073. share/doc/qt5/qtquickcontrols1/images/piemenu-menuitem-example.png
  11074. share/doc/qt5/qtquickcontrols1/images/progressbar.png
  11075. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-calendar.png
  11076. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-filesystembrowser.png
  11077. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-gallery-android-dark.png
  11078. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-gallery-android.png
  11079. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-gallery-osx.png
  11080. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-styles.png
  11081. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-tableview.png
  11082. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-text.png
  11083. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-touch.png
  11084. share/doc/qt5/qtquickcontrols1/images/qtquickcontrols-example-uiforms.png
  11085. share/doc/qt5/qtquickcontrols1/images/radiobutton.png
  11086. share/doc/qt5/qtquickcontrols1/images/scrollview.png
  11087. share/doc/qt5/qtquickcontrols1/images/slider.png
  11088. share/doc/qt5/qtquickcontrols1/images/spinbox.png
  11089. share/doc/qt5/qtquickcontrols1/images/splitview.png
  11090. share/doc/qt5/qtquickcontrols1/images/square-blue.png
  11091. share/doc/qt5/qtquickcontrols1/images/square-green.png
  11092. share/doc/qt5/qtquickcontrols1/images/square-red.png
  11093. share/doc/qt5/qtquickcontrols1/images/square-white.png
  11094. share/doc/qt5/qtquickcontrols1/images/square-yellow.png
  11095. share/doc/qt5/qtquickcontrols1/images/stackview.png
  11096. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-background-example.png
  11097. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-knob-example.png
  11098. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-minorTickmark-example.png
  11099. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-needle-example.png
  11100. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-tickmark-example.png
  11101. share/doc/qt5/qtquickcontrols1/images/styling-circulargauge-tickmarkLabel-example.png
  11102. share/doc/qt5/qtquickcontrols1/images/styling-gauge-font-size.png
  11103. share/doc/qt5/qtquickcontrols1/images/styling-gauge-foreground.png
  11104. share/doc/qt5/qtquickcontrols1/images/styling-gauge-minorTickmark.png
  11105. share/doc/qt5/qtquickcontrols1/images/styling-gauge-tickmark.png
  11106. share/doc/qt5/qtquickcontrols1/images/styling-gauge-valueBar.png
  11107. share/doc/qt5/qtquickcontrols1/images/switch.png
  11108. share/doc/qt5/qtquickcontrols1/images/tableview.png
  11109. share/doc/qt5/qtquickcontrols1/images/tabview.png
  11110. share/doc/qt5/qtquickcontrols1/images/textarea.png
  11111. share/doc/qt5/qtquickcontrols1/images/textfield.png
  11112. share/doc/qt5/qtquickcontrols1/images/toolbar.png
  11113. share/doc/qt5/qtquickcontrols1/images/treeview.png
  11114. share/doc/qt5/qtquickcontrols1/images/tumbler-flat-style.png
  11115. share/doc/qt5/qtquickcontrols1/images/tumbler.png
  11116. share/doc/qt5/qtquickcontrols1/images/used-in-examples/calendar/images/eventindicator.png
  11117. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/bubble.png
  11118. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/button-pressed.png
  11119. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/button.png
  11120. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/progress-background.png
  11121. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/progress-fill.png
  11122. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/slider-handle.png
  11123. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/tab.png
  11124. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/tab_selected.png
  11125. share/doc/qt5/qtquickcontrols1/images/used-in-examples/styles/images/textfield.png
  11126. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/editcopy.png
  11127. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/editcut.png
  11128. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/editpaste.png
  11129. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/editredo.png
  11130. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/editundo.png
  11131. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/exportpdf.png
  11132. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/filenew.png
  11133. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/fileopen.png
  11134. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/fileprint.png
  11135. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/filesave.png
  11136. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/qt-logo.png
  11137. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textbold.png
  11138. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textcenter.png
  11139. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textitalic.png
  11140. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textjustify.png
  11141. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textleft.png
  11142. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textright.png
  11143. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/textunder.png
  11144. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/zoomin.png
  11145. share/doc/qt5/qtquickcontrols1/images/used-in-examples/texteditor/qml/images/zoomout.png
  11146. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/button_default.png
  11147. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/button_pressed.png
  11148. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/navigation_next_item.png
  11149. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/navigation_previous_item.png
  11150. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/tab_selected.png
  11151. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/tabs_standard.png
  11152. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/textinput.png
  11153. share/doc/qt5/qtquickcontrols1/images/used-in-examples/touch/images/toolbar.png
  11154. share/doc/qt5/qtquickcontrols1/menus.html
  11155. share/doc/qt5/qtquickcontrols1/menusstyling.html
  11156. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-action-members.html
  11157. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-action.html
  11158. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-applicationwindow-members.html
  11159. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-applicationwindow.html
  11160. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-busyindicator-members.html
  11161. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-busyindicator.html
  11162. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-button-members.html
  11163. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-button.html
  11164. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-calendar-members.html
  11165. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-calendar.html
  11166. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-checkbox-members.html
  11167. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-checkbox.html
  11168. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-combobox-members.html
  11169. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-combobox.html
  11170. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-exclusivegroup-members.html
  11171. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-exclusivegroup.html
  11172. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-groupbox-members.html
  11173. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-groupbox.html
  11174. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-label-members.html
  11175. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-label.html
  11176. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menu-members.html
  11177. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menu.html
  11178. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menubar-members.html
  11179. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menubar.html
  11180. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menuitem-members.html
  11181. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menuitem.html
  11182. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menuseparator-members.html
  11183. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-menuseparator.html
  11184. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-progressbar-members.html
  11185. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-progressbar.html
  11186. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-radiobutton-members.html
  11187. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-radiobutton.html
  11188. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-scrollview-members.html
  11189. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-scrollview.html
  11190. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-slider-members.html
  11191. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-slider.html
  11192. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-spinbox-members.html
  11193. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-spinbox.html
  11194. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-splitview-members.html
  11195. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-splitview.html
  11196. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stack-members.html
  11197. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stack.html
  11198. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stackview-members.html
  11199. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stackview.html
  11200. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stackviewdelegate-members.html
  11201. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-stackviewdelegate.html
  11202. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-statusbar-members.html
  11203. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-statusbar.html
  11204. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-applicationwindowstyle-members.html
  11205. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-applicationwindowstyle.html
  11206. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-busyindicatorstyle-members.html
  11207. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-busyindicatorstyle.html
  11208. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-buttonstyle-members.html
  11209. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-buttonstyle.html
  11210. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-calendarstyle-members.html
  11211. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-calendarstyle.html
  11212. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-checkboxstyle-members.html
  11213. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-checkboxstyle.html
  11214. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-circulargaugestyle-members.html
  11215. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-circulargaugestyle.html
  11216. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-comboboxstyle-members.html
  11217. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-comboboxstyle.html
  11218. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-delaybuttonstyle-members.html
  11219. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-delaybuttonstyle.html
  11220. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-dialstyle-members.html
  11221. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-dialstyle.html
  11222. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-gaugestyle-members.html
  11223. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-gaugestyle.html
  11224. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-menubarstyle-members.html
  11225. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-menubarstyle.html
  11226. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-menustyle-members.html
  11227. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-menustyle.html
  11228. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-piemenustyle-members.html
  11229. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-piemenustyle.html
  11230. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-progressbarstyle-members.html
  11231. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-progressbarstyle.html
  11232. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-radiobuttonstyle-members.html
  11233. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-radiobuttonstyle.html
  11234. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-scrollviewstyle-members.html
  11235. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-scrollviewstyle.html
  11236. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-sliderstyle-members.html
  11237. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-sliderstyle.html
  11238. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-spinboxstyle-members.html
  11239. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-spinboxstyle.html
  11240. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-statusbarstyle-members.html
  11241. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-statusbarstyle.html
  11242. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-statusindicatorstyle-members.html
  11243. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-statusindicatorstyle.html
  11244. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-switchstyle-members.html
  11245. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-switchstyle.html
  11246. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tableviewstyle-members.html
  11247. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tableviewstyle.html
  11248. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tabviewstyle-members.html
  11249. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tabviewstyle.html
  11250. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-textareastyle-members.html
  11251. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-textareastyle.html
  11252. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-textfieldstyle-members.html
  11253. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-textfieldstyle.html
  11254. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-togglebuttonstyle-members.html
  11255. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-togglebuttonstyle.html
  11256. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-toolbarstyle-members.html
  11257. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-toolbarstyle.html
  11258. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-treeviewstyle-members.html
  11259. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-treeviewstyle.html
  11260. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle-members.html
  11261. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle-obsolete.html
  11262. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle.html
  11263. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-switch-members.html
  11264. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-switch.html
  11265. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tab-members.html
  11266. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tab.html
  11267. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tableview-members.html
  11268. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tableview.html
  11269. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tableviewcolumn-members.html
  11270. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tableviewcolumn.html
  11271. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tabview-members.html
  11272. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-tabview.html
  11273. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-textarea-members.html
  11274. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-textarea.html
  11275. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-textfield-members.html
  11276. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-textfield.html
  11277. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-toolbar-members.html
  11278. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-toolbar.html
  11279. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-toolbutton-members.html
  11280. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-toolbutton.html
  11281. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-treeview-members.html
  11282. share/doc/qt5/qtquickcontrols1/qml-qtquick-controls-treeview.html
  11283. share/doc/qt5/qtquickcontrols1/qtquick-controls-private-qmlmodule.html
  11284. share/doc/qt5/qtquickcontrols1/qtquick-controls-qmlmodule.html
  11285. share/doc/qt5/qtquickcontrols1/qtquick-controls-styles-qmlmodule.html
  11286. share/doc/qt5/qtquickcontrols1/qtquickcontrols-examples.html
  11287. share/doc/qt5/qtquickcontrols1/qtquickcontrols-overview.html
  11288. share/doc/qt5/qtquickcontrols1/qtquickcontrols-platformnotes.html
  11289. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-calendar-pro.html
  11290. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-example.html
  11291. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-qml-main-qml.html
  11292. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-resources-qrc.html
  11293. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-src-event-cpp.html
  11294. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-src-event-h.html
  11295. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-src-main-cpp.html
  11296. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-src-sqleventmodel-cpp.html
  11297. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-calendar-src-sqleventmodel-h.html
  11298. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-filesystembrowser-example.html
  11299. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-filesystembrowser-filesystembrowser-pro.html
  11300. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-filesystembrowser-main-cpp.html
  11301. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-filesystembrowser-main-qml.html
  11302. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-filesystembrowser-qml-qrc.html
  11303. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-example.html
  11304. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-gallery-pro.html
  11305. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-gallery-qrc.html
  11306. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-main-cpp.html
  11307. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-main-qml.html
  11308. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-android-ui-js.html
  11309. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-buttonpage-qml.html
  11310. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-inputpage-qml.html
  11311. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-ios-ui-js.html
  11312. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-osx-ui-js.html
  11313. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-progresspage-qml.html
  11314. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-gallery-qml-ui-js.html
  11315. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-index.html
  11316. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-styles-example.html
  11317. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-styles-main-cpp.html
  11318. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-styles-main-qml.html
  11319. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-styles-styles-pro.html
  11320. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-styles-styles-qrc.html
  11321. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-example.html
  11322. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-main-qml.html
  11323. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-src-main-cpp.html
  11324. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-src-sortfilterproxymodel-cpp.html
  11325. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-src-sortfilterproxymodel-h.html
  11326. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-tableview-pro.html
  11327. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-tableview-tableview-qrc.html
  11328. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-example.html
  11329. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-qml-main-qml.html
  11330. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-qml-toolbarseparator-qml.html
  11331. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-resources-qrc.html
  11332. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-src-documenthandler-cpp.html
  11333. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-src-documenthandler-h.html
  11334. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-src-main-cpp.html
  11335. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-texteditor-texteditor-pro.html
  11336. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-androiddelegate-qml.html
  11337. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-buttonpage-qml.html
  11338. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-listpage-qml.html
  11339. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-progressbarpage-qml.html
  11340. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-sliderpage-qml.html
  11341. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-tabbarpage-qml.html
  11342. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-content-textinputpage-qml.html
  11343. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-example.html
  11344. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-main-qml.html
  11345. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-resources-qrc.html
  11346. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-src-main-cpp.html
  11347. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-touch-pro.html
  11348. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-touch-touch-qmlproject.html
  11349. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-example.html
  11350. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-main-cpp.html
  11351. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-main-qml.html
  11352. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-mainform-ui-qml.html
  11353. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-customermodel-qml.html
  11354. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-history-qml.html
  11355. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-historyform-ui-qml.html
  11356. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-notes-qml.html
  11357. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-notesform-ui-qml.html
  11358. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-settings-qml.html
  11359. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-qml-settingsform-ui-qml.html
  11360. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-uiforms-pro.html
  11361. share/doc/qt5/qtquickcontrols1/qtquickcontrols1-uiforms-uiforms-qrc.html
  11362. share/doc/qt5/qtquickcontrols1/qtquickcontrols1.index
  11363. share/doc/qt5/qtquickcontrols1/qtquickcontrols1.qhp
  11364. share/doc/qt5/qtquickcontrols1/qtquickcontrols1.qhp.sha1
  11365. share/doc/qt5/qtquickcontrols1/qtquickcontrols1.tags
  11366. share/doc/qt5/qtquickcontrols1/qtquickcontrolsstyles-index.html
  11367. share/doc/qt5/qtquickcontrols1/style/offline-simple.css
  11368. share/doc/qt5/qtquickcontrols1/style/offline.css
  11369. share/doc/qt5/qtquickcontrols1/styling-circulargauge.html
  11370. share/doc/qt5/qtquickcontrols1/styling-gauge.html
  11371. share/doc/qt5/qtquickcontrols1/stylingtutorials.html
  11372. share/doc/qt5/qtquickcontrols1/views.html
  11373. share/doc/qt5/qtquickcontrols1/viewsstyling.html
  11374. share/doc/qt5/qtquickdialogs.qch
  11375. share/doc/qt5/qtquickdialogs/examples-manifest.xml
  11376. share/doc/qt5/qtquickdialogs/images/arrow_bc.png
  11377. share/doc/qt5/qtquickdialogs/images/bgrContent.png
  11378. share/doc/qt5/qtquickdialogs/images/btn_next.png
  11379. share/doc/qt5/qtquickdialogs/images/btn_prev.png
  11380. share/doc/qt5/qtquickdialogs/images/bullet_dn.png
  11381. share/doc/qt5/qtquickdialogs/images/bullet_sq.png
  11382. share/doc/qt5/qtquickdialogs/images/critical.png
  11383. share/doc/qt5/qtquickdialogs/images/home.png
  11384. share/doc/qt5/qtquickdialogs/images/ico_note.png
  11385. share/doc/qt5/qtquickdialogs/images/ico_note_attention.png
  11386. share/doc/qt5/qtquickdialogs/images/ico_out.png
  11387. share/doc/qt5/qtquickdialogs/images/information.png
  11388. share/doc/qt5/qtquickdialogs/images/logo.png
  11389. share/doc/qt5/qtquickdialogs/images/question.png
  11390. share/doc/qt5/qtquickdialogs/images/replacefile.png
  11391. share/doc/qt5/qtquickdialogs/images/systemdialogs-example.jpg
  11392. share/doc/qt5/qtquickdialogs/images/warning.png
  11393. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
  11394. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
  11395. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
  11396. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-dialog.html
  11397. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
  11398. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
  11399. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
  11400. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
  11401. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
  11402. share/doc/qt5/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
  11403. share/doc/qt5/qtquickdialogs/qtquick-dialogs-qmlmodule.html
  11404. share/doc/qt5/qtquickdialogs/qtquickdialog-examples.html
  11405. share/doc/qt5/qtquickdialogs/qtquickdialogs-index.html
  11406. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-colordialogs-qml.html
  11407. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-customdialogs-qml.html
  11408. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-example.html
  11409. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-filedialogs-qml.html
  11410. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-fontdialogs-qml.html
  11411. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-main-cpp.html
  11412. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-messagedialogs-qml.html
  11413. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-pro.html
  11414. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qml.html
  11415. share/doc/qt5/qtquickdialogs/qtquickdialogs-systemdialogs-systemdialogs-qrc.html
  11416. share/doc/qt5/qtquickdialogs/qtquickdialogs.index
  11417. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp
  11418. share/doc/qt5/qtquickdialogs/qtquickdialogs.qhp.sha1
  11419. share/doc/qt5/qtquickdialogs/style/offline-simple.css
  11420. share/doc/qt5/qtquickdialogs/style/offline.css
  11421. share/doc/qt5/qtquickextras.qch
  11422. share/doc/qt5/qtquickextras/examples-manifest.xml
  11423. share/doc/qt5/qtquickextras/images/arrow_bc.png
  11424. share/doc/qt5/qtquickextras/images/bgrContent.png
  11425. share/doc/qt5/qtquickextras/images/btn_next.png
  11426. share/doc/qt5/qtquickextras/images/btn_prev.png
  11427. share/doc/qt5/qtquickextras/images/bullet_dn.png
  11428. share/doc/qt5/qtquickextras/images/bullet_sq.png
  11429. share/doc/qt5/qtquickextras/images/circulargauge.png
  11430. share/doc/qt5/qtquickextras/images/delaybutton-activated.png
  11431. share/doc/qt5/qtquickextras/images/delaybutton-progress.png
  11432. share/doc/qt5/qtquickextras/images/delaybutton.png
  11433. share/doc/qt5/qtquickextras/images/dial.png
  11434. share/doc/qt5/qtquickextras/images/gauge.png
  11435. share/doc/qt5/qtquickextras/images/home.png
  11436. share/doc/qt5/qtquickextras/images/ico_note.png
  11437. share/doc/qt5/qtquickextras/images/ico_note_attention.png
  11438. share/doc/qt5/qtquickextras/images/ico_out.png
  11439. share/doc/qt5/qtquickextras/images/logo.png
  11440. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-example.png
  11441. share/doc/qt5/qtquickextras/images/piemenu-boundingItem-null-example.png
  11442. share/doc/qt5/qtquickextras/images/piemenu.png
  11443. share/doc/qt5/qtquickextras/images/qtquickextras-example-dashboard.png
  11444. share/doc/qt5/qtquickextras/images/qtquickextras-example-flat.png
  11445. share/doc/qt5/qtquickextras/images/qtquickextras-example-gallery.png
  11446. share/doc/qt5/qtquickextras/images/statusindicator-active.png
  11447. share/doc/qt5/qtquickextras/images/statusindicator-green.png
  11448. share/doc/qt5/qtquickextras/images/statusindicator-inactive.png
  11449. share/doc/qt5/qtquickextras/images/togglebutton-checked.png
  11450. share/doc/qt5/qtquickextras/images/togglebutton-unchecked.png
  11451. share/doc/qt5/qtquickextras/images/tumbler.png
  11452. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/fuel-icon.png
  11453. share/doc/qt5/qtquickextras/images/used-in-examples/dashboard/images/temperature-icon.png
  11454. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-normal.png
  11455. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-bw-pressed.png
  11456. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-bw.jpg
  11457. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-rgb.jpg
  11458. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-image-sepia.jpg
  11459. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-normal.png
  11460. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-rgb-pressed.png
  11461. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-normal.png
  11462. share/doc/qt5/qtquickextras/images/used-in-examples/flat/images/piemenu-sepia-pressed.png
  11463. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background-light.png
  11464. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/background.png
  11465. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center-light.png
  11466. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/center.png
  11467. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-back.png
  11468. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-go.png
  11469. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/icon-settings.png
  11470. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/info.png
  11471. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle-light.png
  11472. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/needle.png
  11473. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/qt-logo.png
  11474. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_in.png
  11475. share/doc/qt5/qtquickextras/images/used-in-examples/gallery/images/zoom_out.png
  11476. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge-members.html
  11477. share/doc/qt5/qtquickextras/qml-qtquick-extras-circulargauge.html
  11478. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton-members.html
  11479. share/doc/qt5/qtquickextras/qml-qtquick-extras-delaybutton.html
  11480. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial-members.html
  11481. share/doc/qt5/qtquickextras/qml-qtquick-extras-dial.html
  11482. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge-members.html
  11483. share/doc/qt5/qtquickextras/qml-qtquick-extras-gauge.html
  11484. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture-members.html
  11485. share/doc/qt5/qtquickextras/qml-qtquick-extras-picture.html
  11486. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-members.html
  11487. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu-obsolete.html
  11488. share/doc/qt5/qtquickextras/qml-qtquick-extras-piemenu.html
  11489. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-members.html
  11490. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator-obsolete.html
  11491. share/doc/qt5/qtquickextras/qml-qtquick-extras-statusindicator.html
  11492. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton-members.html
  11493. share/doc/qt5/qtquickextras/qml-qtquick-extras-togglebutton.html
  11494. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler-members.html
  11495. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumbler.html
  11496. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn-members.html
  11497. share/doc/qt5/qtquickextras/qml-qtquick-extras-tumblercolumn.html
  11498. share/doc/qt5/qtquickextras/qtquick-extras-qmlmodule.html
  11499. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-pro.html
  11500. share/doc/qt5/qtquickextras/qtquickextras-dashboard-dashboard-qrc.html
  11501. share/doc/qt5/qtquickextras/qtquickextras-dashboard-example.html
  11502. share/doc/qt5/qtquickextras/qtquickextras-dashboard-main-cpp.html
  11503. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboard-qml.html
  11504. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-dashboardgaugestyle-qml.html
  11505. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-icongaugestyle-qml.html
  11506. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-tachometerstyle-qml.html
  11507. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-turnindicator-qml.html
  11508. share/doc/qt5/qtquickextras/qtquickextras-dashboard-qml-valuesource-qml.html
  11509. share/doc/qt5/qtquickextras/qtquickextras-examples.html
  11510. share/doc/qt5/qtquickextras/qtquickextras-flat-content-qml.html
  11511. share/doc/qt5/qtquickextras/qtquickextras-flat-example.html
  11512. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-pro.html
  11513. share/doc/qt5/qtquickextras/qtquickextras-flat-flat-qrc.html
  11514. share/doc/qt5/qtquickextras/qtquickextras-flat-main-cpp.html
  11515. share/doc/qt5/qtquickextras/qtquickextras-flat-main-qml.html
  11516. share/doc/qt5/qtquickextras/qtquickextras-flat-settingsicon-qml.html
  11517. share/doc/qt5/qtquickextras/qtquickextras-gallery-example.html
  11518. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-pro.html
  11519. share/doc/qt5/qtquickextras/qtquickextras-gallery-gallery-qrc.html
  11520. share/doc/qt5/qtquickextras/qtquickextras-gallery-main-cpp.html
  11521. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonbackground-qml.html
  11522. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-blackbuttonstyle-qml.html
  11523. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedarkstyle-qml.html
  11524. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugedefaultstyle-qml.html
  11525. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugelightstyle-qml.html
  11526. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-circulargaugeview-qml.html
  11527. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controllabel-qml.html
  11528. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlview-qml.html
  11529. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-controlviewtoolbar-qml.html
  11530. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerlabel-qml.html
  11531. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerslider-qml.html
  11532. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-customizerswitch-qml.html
  11533. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-flickablemoreindicator-qml.html
  11534. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-gallery-qml.html
  11535. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenucontrolview-qml.html
  11536. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudarkstyle-qml.html
  11537. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-piemenudefaultstyle-qml.html
  11538. share/doc/qt5/qtquickextras/qtquickextras-gallery-qml-stylepicker-qml.html
  11539. share/doc/qt5/qtquickextras/qtquickextras-index.html
  11540. share/doc/qt5/qtquickextras/qtquickextras-overview.html
  11541. share/doc/qt5/qtquickextras/qtquickextras.index
  11542. share/doc/qt5/qtquickextras/qtquickextras.qhp
  11543. share/doc/qt5/qtquickextras/qtquickextras.qhp.sha1
  11544. share/doc/qt5/qtquickextras/style/offline-simple.css
  11545. share/doc/qt5/qtquickextras/style/offline.css
  11546. share/doc/qt5/qtremoteobjects.qch
  11547. share/doc/qt5/qtremoteobjects/images/DirectConnectClientServerOutput.png
  11548. share/doc/qt5/qtremoteobjects/images/DirectConnectServerOutput.png
  11549. share/doc/qt5/qtremoteobjects/images/arrow_bc.png
  11550. share/doc/qt5/qtremoteobjects/images/bgrContent.png
  11551. share/doc/qt5/qtremoteobjects/images/btn_next.png
  11552. share/doc/qt5/qtremoteobjects/images/btn_prev.png
  11553. share/doc/qt5/qtremoteobjects/images/bullet_dn.png
  11554. share/doc/qt5/qtremoteobjects/images/bullet_sq.png
  11555. share/doc/qt5/qtremoteobjects/images/home.png
  11556. share/doc/qt5/qtremoteobjects/images/ico_note.png
  11557. share/doc/qt5/qtremoteobjects/images/ico_note_attention.png
  11558. share/doc/qt5/qtremoteobjects/images/ico_out.png
  11559. share/doc/qt5/qtremoteobjects/images/logo.png
  11560. share/doc/qt5/qtremoteobjects/qml-qtremoteobjects-node-members.html
  11561. share/doc/qt5/qtremoteobjects/qml-qtremoteobjects-node.html
  11562. share/doc/qt5/qtremoteobjects/qml-qtremoteobjects-settingsstore-members.html
  11563. share/doc/qt5/qtremoteobjects/qml-qtremoteobjects-settingsstore.html
  11564. share/doc/qt5/qtremoteobjects/qremoteobjectabstractpersistedstore-members.html
  11565. share/doc/qt5/qtremoteobjects/qremoteobjectabstractpersistedstore-obsolete.html
  11566. share/doc/qt5/qtremoteobjects/qremoteobjectabstractpersistedstore.html
  11567. share/doc/qt5/qtremoteobjects/qremoteobjectdynamicreplica-members.html
  11568. share/doc/qt5/qtremoteobjects/qremoteobjectdynamicreplica-obsolete.html
  11569. share/doc/qt5/qtremoteobjects/qremoteobjectdynamicreplica.html
  11570. share/doc/qt5/qtremoteobjects/qremoteobjecthost-members.html
  11571. share/doc/qt5/qtremoteobjects/qremoteobjecthost-obsolete.html
  11572. share/doc/qt5/qtremoteobjects/qremoteobjecthost.html
  11573. share/doc/qt5/qtremoteobjects/qremoteobjecthostbase-members.html
  11574. share/doc/qt5/qtremoteobjects/qremoteobjecthostbase-obsolete.html
  11575. share/doc/qt5/qtremoteobjects/qremoteobjecthostbase.html
  11576. share/doc/qt5/qtremoteobjects/qremoteobjectnode-members.html
  11577. share/doc/qt5/qtremoteobjects/qremoteobjectnode-obsolete.html
  11578. share/doc/qt5/qtremoteobjects/qremoteobjectnode.html
  11579. share/doc/qt5/qtremoteobjects/qremoteobjectregistry-members.html
  11580. share/doc/qt5/qtremoteobjects/qremoteobjectregistry-obsolete.html
  11581. share/doc/qt5/qtremoteobjects/qremoteobjectregistry.html
  11582. share/doc/qt5/qtremoteobjects/qremoteobjectregistryhost-members.html
  11583. share/doc/qt5/qtremoteobjects/qremoteobjectregistryhost-obsolete.html
  11584. share/doc/qt5/qtremoteobjects/qremoteobjectregistryhost.html
  11585. share/doc/qt5/qtremoteobjects/qremoteobjectreplica-members.html
  11586. share/doc/qt5/qtremoteobjects/qremoteobjectreplica-obsolete.html
  11587. share/doc/qt5/qtremoteobjects/qremoteobjectreplica.html
  11588. share/doc/qt5/qtremoteobjects/qtremoteobjects-external-schemas.html
  11589. share/doc/qt5/qtremoteobjects/qtremoteobjects-gettingstarted.html
  11590. share/doc/qt5/qtremoteobjects/qtremoteobjects-index.html
  11591. share/doc/qt5/qtremoteobjects/qtremoteobjects-interaction.html
  11592. share/doc/qt5/qtremoteobjects/qtremoteobjects-module.html
  11593. share/doc/qt5/qtremoteobjects/qtremoteobjects-node.html
  11594. share/doc/qt5/qtremoteobjects/qtremoteobjects-qmlmodule.html
  11595. share/doc/qt5/qtremoteobjects/qtremoteobjects-registry.html
  11596. share/doc/qt5/qtremoteobjects/qtremoteobjects-repc.html
  11597. share/doc/qt5/qtremoteobjects/qtremoteobjects-replica.html
  11598. share/doc/qt5/qtremoteobjects/qtremoteobjects-source.html
  11599. share/doc/qt5/qtremoteobjects/qtremoteobjects-troubleshooting.html
  11600. share/doc/qt5/qtremoteobjects/qtremoteobjects-use.html
  11601. share/doc/qt5/qtremoteobjects/qtremoteobjects.index
  11602. share/doc/qt5/qtremoteobjects/qtremoteobjects.qhp
  11603. share/doc/qt5/qtremoteobjects/qtremoteobjects.qhp.sha1
  11604. share/doc/qt5/qtremoteobjects/qtremoteobjects.tags
  11605. share/doc/qt5/qtremoteobjects/qtroclientfactory-members.html
  11606. share/doc/qt5/qtremoteobjects/qtroclientfactory.html
  11607. share/doc/qt5/qtremoteobjects/qtroserverfactory-members.html
  11608. share/doc/qt5/qtremoteobjects/qtroserverfactory.html
  11609. share/doc/qt5/qtremoteobjects/style/offline-simple.css
  11610. share/doc/qt5/qtremoteobjects/style/offline.css
  11611. share/doc/qt5/qtscxml.qch
  11612. share/doc/qt5/qtscxml/examples-manifest.xml
  11613. share/doc/qt5/qtscxml/examples-qtscxml.html
  11614. share/doc/qt5/qtscxml/images/arrow_bc.png
  11615. share/doc/qt5/qtscxml/images/bgrContent.png
  11616. share/doc/qt5/qtscxml/images/btn_next.png
  11617. share/doc/qt5/qtscxml/images/btn_prev.png
  11618. share/doc/qt5/qtscxml/images/bullet_dn.png
  11619. share/doc/qt5/qtscxml/images/bullet_sq.png
  11620. share/doc/qt5/qtscxml/images/calculator-qml.png
  11621. share/doc/qt5/qtscxml/images/calculator.png
  11622. share/doc/qt5/qtscxml/images/ftpclient-statechart.png
  11623. share/doc/qt5/qtscxml/images/home.png
  11624. share/doc/qt5/qtscxml/images/ico_note.png
  11625. share/doc/qt5/qtscxml/images/ico_note_attention.png
  11626. share/doc/qt5/qtscxml/images/ico_out.png
  11627. share/doc/qt5/qtscxml/images/invoke-dynamic.png
  11628. share/doc/qt5/qtscxml/images/invoke-static.png
  11629. share/doc/qt5/qtscxml/images/logo.png
  11630. share/doc/qt5/qtscxml/images/mediaplayer.png
  11631. share/doc/qt5/qtscxml/images/pinball-statechart-global.png
  11632. share/doc/qt5/qtscxml/images/pinball-statechart-guicontrol.png
  11633. share/doc/qt5/qtscxml/images/pinball-statechart-internalstate.png
  11634. share/doc/qt5/qtscxml/images/pinball-statechart-logicalstate.png
  11635. share/doc/qt5/qtscxml/images/pinball-statechart-modestate.png
  11636. share/doc/qt5/qtscxml/images/pinball-statechart-onstate.png
  11637. share/doc/qt5/qtscxml/images/pinball-statechart-workflow.png
  11638. share/doc/qt5/qtscxml/images/pinball.png
  11639. share/doc/qt5/qtscxml/images/sudoku.png
  11640. share/doc/qt5/qtscxml/images/trafficlight.png
  11641. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic-members.html
  11642. share/doc/qt5/qtscxml/qml-mediaplayer-qml-dynamic.html
  11643. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection-members.html
  11644. share/doc/qt5/qtscxml/qml-qtscxml-eventconnection.html
  11645. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices-members.html
  11646. share/doc/qt5/qtscxml/qml-qtscxml-invokedservices.html
  11647. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine-members.html
  11648. share/doc/qt5/qtscxml/qml-qtscxml-scxmlstatemachine.html
  11649. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader-members.html
  11650. share/doc/qt5/qtscxml/qml-qtscxml-statemachineloader.html
  11651. share/doc/qt5/qtscxml/qscxmlc.html
  11652. share/doc/qt5/qtscxml/qscxmlcompiler-loader-members.html
  11653. share/doc/qt5/qtscxml/qscxmlcompiler-loader.html
  11654. share/doc/qt5/qtscxml/qscxmlcompiler-members.html
  11655. share/doc/qt5/qtscxml/qscxmlcompiler.html
  11656. share/doc/qt5/qtscxml/qscxmlcppdatamodel-members.html
  11657. share/doc/qt5/qtscxml/qscxmlcppdatamodel-obsolete.html
  11658. share/doc/qt5/qtscxml/qscxmlcppdatamodel.html
  11659. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody-members.html
  11660. share/doc/qt5/qtscxml/qscxmldatamodel-foreachloopbody.html
  11661. share/doc/qt5/qtscxml/qscxmldatamodel-members.html
  11662. share/doc/qt5/qtscxml/qscxmldatamodel-obsolete.html
  11663. share/doc/qt5/qtscxml/qscxmldatamodel.html
  11664. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory-members.html
  11665. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory-obsolete.html
  11666. share/doc/qt5/qtscxml/qscxmldynamicscxmlservicefactory.html
  11667. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel-members.html
  11668. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel-obsolete.html
  11669. share/doc/qt5/qtscxml/qscxmlecmascriptdatamodel.html
  11670. share/doc/qt5/qtscxml/qscxmlerror-members.html
  11671. share/doc/qt5/qtscxml/qscxmlerror.html
  11672. share/doc/qt5/qtscxml/qscxmlevent-members.html
  11673. share/doc/qt5/qtscxml/qscxmlevent.html
  11674. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo-members.html
  11675. share/doc/qt5/qtscxml/qscxmlexecutablecontent-assignmentinfo.html
  11676. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo-members.html
  11677. share/doc/qt5/qtscxml/qscxmlexecutablecontent-evaluatorinfo.html
  11678. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo-members.html
  11679. share/doc/qt5/qtscxml/qscxmlexecutablecontent-foreachinfo.html
  11680. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo-members.html
  11681. share/doc/qt5/qtscxml/qscxmlexecutablecontent-invokeinfo.html
  11682. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo-members.html
  11683. share/doc/qt5/qtscxml/qscxmlexecutablecontent-parameterinfo.html
  11684. share/doc/qt5/qtscxml/qscxmlexecutablecontent.html
  11685. share/doc/qt5/qtscxml/qscxmlinvokableservice-members.html
  11686. share/doc/qt5/qtscxml/qscxmlinvokableservice-obsolete.html
  11687. share/doc/qt5/qtscxml/qscxmlinvokableservice.html
  11688. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory-members.html
  11689. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory-obsolete.html
  11690. share/doc/qt5/qtscxml/qscxmlinvokableservicefactory.html
  11691. share/doc/qt5/qtscxml/qscxmlnulldatamodel-members.html
  11692. share/doc/qt5/qtscxml/qscxmlnulldatamodel-obsolete.html
  11693. share/doc/qt5/qtscxml/qscxmlnulldatamodel.html
  11694. share/doc/qt5/qtscxml/qscxmlstatemachine-members.html
  11695. share/doc/qt5/qtscxml/qscxmlstatemachine-obsolete.html
  11696. share/doc/qt5/qtscxml/qscxmlstatemachine.html
  11697. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory-members.html
  11698. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory-obsolete.html
  11699. share/doc/qt5/qtscxml/qscxmlstaticscxmlservicefactory.html
  11700. share/doc/qt5/qtscxml/qscxmltabledata-members.html
  11701. share/doc/qt5/qtscxml/qscxmltabledata.html
  11702. share/doc/qt5/qtscxml/qtscxml-calculator-qml-button-qml.html
  11703. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-cpp.html
  11704. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-pro.html
  11705. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qml.html
  11706. share/doc/qt5/qtscxml/qtscxml-calculator-qml-calculator-qml-qrc.html
  11707. share/doc/qt5/qtscxml/qtscxml-calculator-qml-example.html
  11708. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-cpp.html
  11709. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-calculator-widgets-pro.html
  11710. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-example.html
  11711. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-cpp.html
  11712. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-h.html
  11713. share/doc/qt5/qtscxml/qtscxml-calculator-widgets-mainwindow-ui.html
  11714. share/doc/qt5/qtscxml/qtscxml-ftpclient-example.html
  11715. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpclient-pro.html
  11716. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-cpp.html
  11717. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpcontrolchannel-h.html
  11718. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-cpp.html
  11719. share/doc/qt5/qtscxml/qtscxml-ftpclient-ftpdatachannel-h.html
  11720. share/doc/qt5/qtscxml/qtscxml-ftpclient-main-cpp.html
  11721. share/doc/qt5/qtscxml/qtscxml-ftpclient-simpleftp-scxml.html
  11722. share/doc/qt5/qtscxml/qtscxml-index.html
  11723. share/doc/qt5/qtscxml/qtscxml-instantiating-state-machines.html
  11724. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-example.html
  11725. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-cpp.html
  11726. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-pro.html
  11727. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qml.html
  11728. share/doc/qt5/qtscxml/qtscxml-invoke-dynamic-invoke-dynamic-qrc.html
  11729. share/doc/qt5/qtscxml/qtscxml-invoke-static-example.html
  11730. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-cpp.html
  11731. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-pro.html
  11732. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qml.html
  11733. share/doc/qt5/qtscxml/qtscxml-invoke-static-invoke-static-qrc.html
  11734. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-example.html
  11735. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-cppdatamodel-scxml.html
  11736. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-cpp.html
  11737. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-pro.html
  11738. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qml.html
  11739. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-mediaplayer-qml-cppdatamodel-qrc.html
  11740. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-cpp.html
  11741. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-thedatamodel-h.html
  11742. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-example.html
  11743. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-cpp.html
  11744. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-pro.html
  11745. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qml.html
  11746. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-dynamic-mediaplayer-qml-dynamic-qrc.html
  11747. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-example.html
  11748. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-cpp.html
  11749. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-pro.html
  11750. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qml.html
  11751. share/doc/qt5/qtscxml/qtscxml-mediaplayer-qml-static-mediaplayer-qml-static-qrc.html
  11752. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-example.html
  11753. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-qrc.html
  11754. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-cpp.html
  11755. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-dynamic-mediaplayer-widgets-dynamic-pro.html
  11756. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-example.html
  11757. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-cpp.html
  11758. share/doc/qt5/qtscxml/qtscxml-mediaplayer-widgets-static-mediaplayer-widgets-static-pro.html
  11759. share/doc/qt5/qtscxml/qtscxml-module.html
  11760. share/doc/qt5/qtscxml/qtscxml-overview.html
  11761. share/doc/qt5/qtscxml/qtscxml-pinball-example.html
  11762. share/doc/qt5/qtscxml/qtscxml-pinball-main-cpp.html
  11763. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-cpp.html
  11764. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-h.html
  11765. share/doc/qt5/qtscxml/qtscxml-pinball-mainwindow-ui.html
  11766. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-pro.html
  11767. share/doc/qt5/qtscxml/qtscxml-pinball-pinball-scxml.html
  11768. share/doc/qt5/qtscxml/qtscxml-qmlmodule.html
  11769. share/doc/qt5/qtscxml/qtscxml-scxml-compliance.html
  11770. share/doc/qt5/qtscxml/qtscxml-sudoku-example.html
  11771. share/doc/qt5/qtscxml/qtscxml-sudoku-main-cpp.html
  11772. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-cpp.html
  11773. share/doc/qt5/qtscxml/qtscxml-sudoku-mainwindow-h.html
  11774. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-js.html
  11775. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-pro.html
  11776. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-qrc.html
  11777. share/doc/qt5/qtscxml/qtscxml-sudoku-sudoku-scxml.html
  11778. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
  11779. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-cpp.html
  11780. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-pro.html
  11781. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qml.html
  11782. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-dynamic-trafficlight-qml-dynamic-qrc.html
  11783. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-example.html
  11784. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-light-qml.html
  11785. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-cpp.html
  11786. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-pro.html
  11787. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml-simple-qrc.html
  11788. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-simple-trafficlight-qml.html
  11789. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-example.html
  11790. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-cpp.html
  11791. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-pro.html
  11792. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qml.html
  11793. share/doc/qt5/qtscxml/qtscxml-trafficlight-qml-static-trafficlight-qml-static-qrc.html
  11794. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
  11795. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-cpp.html
  11796. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-pro.html
  11797. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-dynamic-trafficlight-widgets-dynamic-qrc.html
  11798. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-example.html
  11799. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-cpp.html
  11800. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-pro.html
  11801. share/doc/qt5/qtscxml/qtscxml-trafficlight-widgets-static-trafficlight-widgets-static-qrc.html
  11802. share/doc/qt5/qtscxml/qtscxml.index
  11803. share/doc/qt5/qtscxml/qtscxml.qhp
  11804. share/doc/qt5/qtscxml/qtscxml.qhp.sha1
  11805. share/doc/qt5/qtscxml/qtscxml.tags
  11806. share/doc/qt5/qtscxml/style/offline-simple.css
  11807. share/doc/qt5/qtscxml/style/offline.css
  11808. share/doc/qt5/qtsensors.qch
  11809. share/doc/qt5/qtsensors/compatmap.html
  11810. share/doc/qt5/qtsensors/creating-a-sensor-plugin.html
  11811. share/doc/qt5/qtsensors/determining-the-default-sensor-for-a-type.html
  11812. share/doc/qt5/qtsensors/dynamic-sensor-backend-registration.html
  11813. share/doc/qt5/qtsensors/examples-manifest.xml
  11814. share/doc/qt5/qtsensors/genericbackend.html
  11815. share/doc/qt5/qtsensors/images/accelbubble.png
  11816. share/doc/qt5/qtsensors/images/arrow_bc.png
  11817. share/doc/qt5/qtsensors/images/bgrContent.png
  11818. share/doc/qt5/qtsensors/images/btn_next.png
  11819. share/doc/qt5/qtsensors/images/btn_prev.png
  11820. share/doc/qt5/qtsensors/images/bullet_dn.png
  11821. share/doc/qt5/qtsensors/images/bullet_sq.png
  11822. share/doc/qt5/qtsensors/images/home.png
  11823. share/doc/qt5/qtsensors/images/ico_note.png
  11824. share/doc/qt5/qtsensors/images/ico_note_attention.png
  11825. share/doc/qt5/qtsensors/images/ico_out.png
  11826. share/doc/qt5/qtsensors/images/logo.png
  11827. share/doc/qt5/qtsensors/images/maze.png
  11828. share/doc/qt5/qtsensors/images/qmlqtsensors.png
  11829. share/doc/qt5/qtsensors/images/qtsensors-examples-explorer.png
  11830. share/doc/qt5/qtsensors/images/qtsensors-examples-grue.png
  11831. share/doc/qt5/qtsensors/images/sensorgesture-cover.png
  11832. share/doc/qt5/qtsensors/images/sensorgesture-doubletap.png
  11833. share/doc/qt5/qtsensors/images/sensorgesture-facedown.png
  11834. share/doc/qt5/qtsensors/images/sensorgesture-faceup.png
  11835. share/doc/qt5/qtsensors/images/sensorgesture-hover.png
  11836. share/doc/qt5/qtsensors/images/sensorgesture-shake.png
  11837. share/doc/qt5/qtsensors/images/sensorgesture-slam_1.png
  11838. share/doc/qt5/qtsensors/images/sensorgesture-slam_2.png
  11839. share/doc/qt5/qtsensors/images/sensorgesture-twist.png
  11840. share/doc/qt5/qtsensors/images/sensorgesture-whip.png
  11841. share/doc/qt5/qtsensors/images/sensorgesturecpp.png
  11842. share/doc/qt5/qtsensors/images/sensors-coordinates.jpg
  11843. share/doc/qt5/qtsensors/images/sensors-coordinates2.jpg
  11844. share/doc/qt5/qtsensors/images/sensors-coordinates3.jpg
  11845. share/doc/qt5/qtsensors/images/sensors-dynamic.png
  11846. share/doc/qt5/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
  11847. share/doc/qt5/qtsensors/images/sensors-orientation.jpg
  11848. share/doc/qt5/qtsensors/images/sensors-overview.png
  11849. share/doc/qt5/qtsensors/images/sensors-rotation-anim.gif
  11850. share/doc/qt5/qtsensors/images/sensors-rotation.jpg
  11851. share/doc/qt5/qtsensors/images/sensors-rotation2.jpg
  11852. share/doc/qt5/qtsensors/images/sensors-rotation3.jpg
  11853. share/doc/qt5/qtsensors/images/sensors-sides.jpg
  11854. share/doc/qt5/qtsensors/images/sensors-sides2.jpg
  11855. share/doc/qt5/qtsensors/images/sensors-static.png
  11856. share/doc/qt5/qtsensors/images/shakeit.png
  11857. share/doc/qt5/qtsensors/images/used-in-examples/grue/grue.png
  11858. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_disabled.png
  11859. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_normal.png
  11860. share/doc/qt5/qtsensors/images/used-in-examples/maze/components/images/button_background_pressed.png
  11861. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/00.png
  11862. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/01.png
  11863. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/cheese.png
  11864. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/cheeseeating.gif
  11865. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/congratulations.gif
  11866. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/mouse_down.gif
  11867. share/doc/qt5/qtsensors/images/used-in-examples/maze/content/start.png
  11868. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_disabled.png
  11869. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_normal.png
  11870. share/doc/qt5/qtsensors/images/used-in-examples/qmlqtsensors/components/images/button_background_pressed.png
  11871. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle.png
  11872. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle2.png
  11873. share/doc/qt5/qtsensors/images/used-in-examples/shakeit/content/triangle3.png
  11874. share/doc/qt5/qtsensors/qaccelerometer-members.html
  11875. share/doc/qt5/qtsensors/qaccelerometer-obsolete.html
  11876. share/doc/qt5/qtsensors/qaccelerometer.html
  11877. share/doc/qt5/qtsensors/qaccelerometerfilter-members.html
  11878. share/doc/qt5/qtsensors/qaccelerometerfilter.html
  11879. share/doc/qt5/qtsensors/qaccelerometerreading-members.html
  11880. share/doc/qt5/qtsensors/qaccelerometerreading-obsolete.html
  11881. share/doc/qt5/qtsensors/qaccelerometerreading.html
  11882. share/doc/qt5/qtsensors/qaltimeter-members.html
  11883. share/doc/qt5/qtsensors/qaltimeter-obsolete.html
  11884. share/doc/qt5/qtsensors/qaltimeter.html
  11885. share/doc/qt5/qtsensors/qaltimeterfilter-members.html
  11886. share/doc/qt5/qtsensors/qaltimeterfilter.html
  11887. share/doc/qt5/qtsensors/qaltimeterreading-members.html
  11888. share/doc/qt5/qtsensors/qaltimeterreading-obsolete.html
  11889. share/doc/qt5/qtsensors/qaltimeterreading.html
  11890. share/doc/qt5/qtsensors/qambientlightfilter-members.html
  11891. share/doc/qt5/qtsensors/qambientlightfilter.html
  11892. share/doc/qt5/qtsensors/qambientlightreading-members.html
  11893. share/doc/qt5/qtsensors/qambientlightreading-obsolete.html
  11894. share/doc/qt5/qtsensors/qambientlightreading.html
  11895. share/doc/qt5/qtsensors/qambientlightsensor-members.html
  11896. share/doc/qt5/qtsensors/qambientlightsensor-obsolete.html
  11897. share/doc/qt5/qtsensors/qambientlightsensor.html
  11898. share/doc/qt5/qtsensors/qambienttemperaturefilter-members.html
  11899. share/doc/qt5/qtsensors/qambienttemperaturefilter.html
  11900. share/doc/qt5/qtsensors/qambienttemperaturereading-members.html
  11901. share/doc/qt5/qtsensors/qambienttemperaturereading-obsolete.html
  11902. share/doc/qt5/qtsensors/qambienttemperaturereading.html
  11903. share/doc/qt5/qtsensors/qambienttemperaturesensor-members.html
  11904. share/doc/qt5/qtsensors/qambienttemperaturesensor-obsolete.html
  11905. share/doc/qt5/qtsensors/qambienttemperaturesensor.html
  11906. share/doc/qt5/qtsensors/qcompass-members.html
  11907. share/doc/qt5/qtsensors/qcompass-obsolete.html
  11908. share/doc/qt5/qtsensors/qcompass.html
  11909. share/doc/qt5/qtsensors/qcompassfilter-members.html
  11910. share/doc/qt5/qtsensors/qcompassfilter.html
  11911. share/doc/qt5/qtsensors/qcompassreading-members.html
  11912. share/doc/qt5/qtsensors/qcompassreading-obsolete.html
  11913. share/doc/qt5/qtsensors/qcompassreading.html
  11914. share/doc/qt5/qtsensors/qdistancefilter-members.html
  11915. share/doc/qt5/qtsensors/qdistancefilter.html
  11916. share/doc/qt5/qtsensors/qdistancereading-members.html
  11917. share/doc/qt5/qtsensors/qdistancereading-obsolete.html
  11918. share/doc/qt5/qtsensors/qdistancereading.html
  11919. share/doc/qt5/qtsensors/qdistancesensor-members.html
  11920. share/doc/qt5/qtsensors/qdistancesensor-obsolete.html
  11921. share/doc/qt5/qtsensors/qdistancesensor.html
  11922. share/doc/qt5/qtsensors/qgyroscope-members.html
  11923. share/doc/qt5/qtsensors/qgyroscope-obsolete.html
  11924. share/doc/qt5/qtsensors/qgyroscope.html
  11925. share/doc/qt5/qtsensors/qgyroscopefilter-members.html
  11926. share/doc/qt5/qtsensors/qgyroscopefilter.html
  11927. share/doc/qt5/qtsensors/qgyroscopereading-members.html
  11928. share/doc/qt5/qtsensors/qgyroscopereading-obsolete.html
  11929. share/doc/qt5/qtsensors/qgyroscopereading.html
  11930. share/doc/qt5/qtsensors/qholsterfilter-members.html
  11931. share/doc/qt5/qtsensors/qholsterfilter.html
  11932. share/doc/qt5/qtsensors/qholsterreading-members.html
  11933. share/doc/qt5/qtsensors/qholsterreading-obsolete.html
  11934. share/doc/qt5/qtsensors/qholsterreading.html
  11935. share/doc/qt5/qtsensors/qholstersensor-members.html
  11936. share/doc/qt5/qtsensors/qholstersensor-obsolete.html
  11937. share/doc/qt5/qtsensors/qholstersensor.html
  11938. share/doc/qt5/qtsensors/qhumidityfilter-members.html
  11939. share/doc/qt5/qtsensors/qhumidityfilter.html
  11940. share/doc/qt5/qtsensors/qhumidityreading-members.html
  11941. share/doc/qt5/qtsensors/qhumidityreading-obsolete.html
  11942. share/doc/qt5/qtsensors/qhumidityreading.html
  11943. share/doc/qt5/qtsensors/qhumiditysensor-members.html
  11944. share/doc/qt5/qtsensors/qhumiditysensor-obsolete.html
  11945. share/doc/qt5/qtsensors/qhumiditysensor.html
  11946. share/doc/qt5/qtsensors/qirproximityfilter-members.html
  11947. share/doc/qt5/qtsensors/qirproximityfilter.html
  11948. share/doc/qt5/qtsensors/qirproximityreading-members.html
  11949. share/doc/qt5/qtsensors/qirproximityreading-obsolete.html
  11950. share/doc/qt5/qtsensors/qirproximityreading.html
  11951. share/doc/qt5/qtsensors/qirproximitysensor-members.html
  11952. share/doc/qt5/qtsensors/qirproximitysensor-obsolete.html
  11953. share/doc/qt5/qtsensors/qirproximitysensor.html
  11954. share/doc/qt5/qtsensors/qlidfilter-members.html
  11955. share/doc/qt5/qtsensors/qlidfilter.html
  11956. share/doc/qt5/qtsensors/qlidreading-members.html
  11957. share/doc/qt5/qtsensors/qlidreading-obsolete.html
  11958. share/doc/qt5/qtsensors/qlidreading.html
  11959. share/doc/qt5/qtsensors/qlidsensor-members.html
  11960. share/doc/qt5/qtsensors/qlidsensor-obsolete.html
  11961. share/doc/qt5/qtsensors/qlidsensor.html
  11962. share/doc/qt5/qtsensors/qlightfilter-members.html
  11963. share/doc/qt5/qtsensors/qlightfilter.html
  11964. share/doc/qt5/qtsensors/qlightreading-members.html
  11965. share/doc/qt5/qtsensors/qlightreading-obsolete.html
  11966. share/doc/qt5/qtsensors/qlightreading.html
  11967. share/doc/qt5/qtsensors/qlightsensor-members.html
  11968. share/doc/qt5/qtsensors/qlightsensor-obsolete.html
  11969. share/doc/qt5/qtsensors/qlightsensor.html
  11970. share/doc/qt5/qtsensors/qmagnetometer-members.html
  11971. share/doc/qt5/qtsensors/qmagnetometer-obsolete.html
  11972. share/doc/qt5/qtsensors/qmagnetometer.html
  11973. share/doc/qt5/qtsensors/qmagnetometerfilter-members.html
  11974. share/doc/qt5/qtsensors/qmagnetometerfilter.html
  11975. share/doc/qt5/qtsensors/qmagnetometerreading-members.html
  11976. share/doc/qt5/qtsensors/qmagnetometerreading-obsolete.html
  11977. share/doc/qt5/qtsensors/qmagnetometerreading.html
  11978. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer-members.html
  11979. share/doc/qt5/qtsensors/qml-qtsensors-accelerometer.html
  11980. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading-members.html
  11981. share/doc/qt5/qtsensors/qml-qtsensors-accelerometerreading.html
  11982. share/doc/qt5/qtsensors/qml-qtsensors-altimeter-members.html
  11983. share/doc/qt5/qtsensors/qml-qtsensors-altimeter.html
  11984. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading-members.html
  11985. share/doc/qt5/qtsensors/qml-qtsensors-altimeterreading.html
  11986. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading-members.html
  11987. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightreading.html
  11988. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor-members.html
  11989. share/doc/qt5/qtsensors/qml-qtsensors-ambientlightsensor.html
  11990. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
  11991. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturereading.html
  11992. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
  11993. share/doc/qt5/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
  11994. share/doc/qt5/qtsensors/qml-qtsensors-compass-members.html
  11995. share/doc/qt5/qtsensors/qml-qtsensors-compass.html
  11996. share/doc/qt5/qtsensors/qml-qtsensors-compassreading-members.html
  11997. share/doc/qt5/qtsensors/qml-qtsensors-compassreading.html
  11998. share/doc/qt5/qtsensors/qml-qtsensors-distancereading-members.html
  11999. share/doc/qt5/qtsensors/qml-qtsensors-distancereading.html
  12000. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor-members.html
  12001. share/doc/qt5/qtsensors/qml-qtsensors-distancesensor.html
  12002. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope-members.html
  12003. share/doc/qt5/qtsensors/qml-qtsensors-gyroscope.html
  12004. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading-members.html
  12005. share/doc/qt5/qtsensors/qml-qtsensors-gyroscopereading.html
  12006. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading-members.html
  12007. share/doc/qt5/qtsensors/qml-qtsensors-holsterreading.html
  12008. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor-members.html
  12009. share/doc/qt5/qtsensors/qml-qtsensors-holstersensor.html
  12010. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading-members.html
  12011. share/doc/qt5/qtsensors/qml-qtsensors-humidityreading.html
  12012. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor-members.html
  12013. share/doc/qt5/qtsensors/qml-qtsensors-humiditysensor.html
  12014. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading-members.html
  12015. share/doc/qt5/qtsensors/qml-qtsensors-irproximityreading.html
  12016. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor-members.html
  12017. share/doc/qt5/qtsensors/qml-qtsensors-irproximitysensor.html
  12018. share/doc/qt5/qtsensors/qml-qtsensors-lidreading-members.html
  12019. share/doc/qt5/qtsensors/qml-qtsensors-lidreading.html
  12020. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor-members.html
  12021. share/doc/qt5/qtsensors/qml-qtsensors-lidsensor.html
  12022. share/doc/qt5/qtsensors/qml-qtsensors-lightreading-members.html
  12023. share/doc/qt5/qtsensors/qml-qtsensors-lightreading.html
  12024. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor-members.html
  12025. share/doc/qt5/qtsensors/qml-qtsensors-lightsensor.html
  12026. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer-members.html
  12027. share/doc/qt5/qtsensors/qml-qtsensors-magnetometer.html
  12028. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading-members.html
  12029. share/doc/qt5/qtsensors/qml-qtsensors-magnetometerreading.html
  12030. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading-members.html
  12031. share/doc/qt5/qtsensors/qml-qtsensors-orientationreading.html
  12032. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor-members.html
  12033. share/doc/qt5/qtsensors/qml-qtsensors-orientationsensor.html
  12034. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading-members.html
  12035. share/doc/qt5/qtsensors/qml-qtsensors-pressurereading.html
  12036. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor-members.html
  12037. share/doc/qt5/qtsensors/qml-qtsensors-pressuresensor.html
  12038. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading-members.html
  12039. share/doc/qt5/qtsensors/qml-qtsensors-proximityreading.html
  12040. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor-members.html
  12041. share/doc/qt5/qtsensors/qml-qtsensors-proximitysensor.html
  12042. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading-members.html
  12043. share/doc/qt5/qtsensors/qml-qtsensors-rotationreading.html
  12044. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor-members.html
  12045. share/doc/qt5/qtsensors/qml-qtsensors-rotationsensor.html
  12046. share/doc/qt5/qtsensors/qml-qtsensors-sensor-members.html
  12047. share/doc/qt5/qtsensors/qml-qtsensors-sensor.html
  12048. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture-members.html
  12049. share/doc/qt5/qtsensors/qml-qtsensors-sensorgesture.html
  12050. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal-members.html
  12051. share/doc/qt5/qtsensors/qml-qtsensors-sensorglobal.html
  12052. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading-members.html
  12053. share/doc/qt5/qtsensors/qml-qtsensors-sensorreading.html
  12054. share/doc/qt5/qtsensors/qml-qtsensors-tapreading-members.html
  12055. share/doc/qt5/qtsensors/qml-qtsensors-tapreading.html
  12056. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor-members.html
  12057. share/doc/qt5/qtsensors/qml-qtsensors-tapsensor.html
  12058. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading-members.html
  12059. share/doc/qt5/qtsensors/qml-qtsensors-tiltreading.html
  12060. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor-members.html
  12061. share/doc/qt5/qtsensors/qml-qtsensors-tiltsensor.html
  12062. share/doc/qt5/qtsensors/qorientationfilter-members.html
  12063. share/doc/qt5/qtsensors/qorientationfilter.html
  12064. share/doc/qt5/qtsensors/qorientationreading-members.html
  12065. share/doc/qt5/qtsensors/qorientationreading-obsolete.html
  12066. share/doc/qt5/qtsensors/qorientationreading.html
  12067. share/doc/qt5/qtsensors/qorientationsensor-members.html
  12068. share/doc/qt5/qtsensors/qorientationsensor-obsolete.html
  12069. share/doc/qt5/qtsensors/qorientationsensor.html
  12070. share/doc/qt5/qtsensors/qoutputrange-members.html
  12071. share/doc/qt5/qtsensors/qoutputrange.html
  12072. share/doc/qt5/qtsensors/qpressurefilter-members.html
  12073. share/doc/qt5/qtsensors/qpressurefilter.html
  12074. share/doc/qt5/qtsensors/qpressurereading-members.html
  12075. share/doc/qt5/qtsensors/qpressurereading-obsolete.html
  12076. share/doc/qt5/qtsensors/qpressurereading.html
  12077. share/doc/qt5/qtsensors/qpressuresensor-members.html
  12078. share/doc/qt5/qtsensors/qpressuresensor-obsolete.html
  12079. share/doc/qt5/qtsensors/qpressuresensor.html
  12080. share/doc/qt5/qtsensors/qproximityfilter-members.html
  12081. share/doc/qt5/qtsensors/qproximityfilter.html
  12082. share/doc/qt5/qtsensors/qproximityreading-members.html
  12083. share/doc/qt5/qtsensors/qproximityreading-obsolete.html
  12084. share/doc/qt5/qtsensors/qproximityreading.html
  12085. share/doc/qt5/qtsensors/qproximitysensor-members.html
  12086. share/doc/qt5/qtsensors/qproximitysensor-obsolete.html
  12087. share/doc/qt5/qtsensors/qproximitysensor.html
  12088. share/doc/qt5/qtsensors/qrotationfilter-members.html
  12089. share/doc/qt5/qtsensors/qrotationfilter.html
  12090. share/doc/qt5/qtsensors/qrotationreading-members.html
  12091. share/doc/qt5/qtsensors/qrotationreading-obsolete.html
  12092. share/doc/qt5/qtsensors/qrotationreading.html
  12093. share/doc/qt5/qtsensors/qrotationsensor-members.html
  12094. share/doc/qt5/qtsensors/qrotationsensor-obsolete.html
  12095. share/doc/qt5/qtsensors/qrotationsensor.html
  12096. share/doc/qt5/qtsensors/qsensor-members.html
  12097. share/doc/qt5/qtsensors/qsensor-obsolete.html
  12098. share/doc/qt5/qtsensors/qsensor.html
  12099. share/doc/qt5/qtsensors/qsensorbackend-members.html
  12100. share/doc/qt5/qtsensors/qsensorbackend-obsolete.html
  12101. share/doc/qt5/qtsensors/qsensorbackend.html
  12102. share/doc/qt5/qtsensors/qsensorbackendfactory-members.html
  12103. share/doc/qt5/qtsensors/qsensorbackendfactory.html
  12104. share/doc/qt5/qtsensors/qsensorchangesinterface-members.html
  12105. share/doc/qt5/qtsensors/qsensorchangesinterface.html
  12106. share/doc/qt5/qtsensors/qsensorfilter-members.html
  12107. share/doc/qt5/qtsensors/qsensorfilter.html
  12108. share/doc/qt5/qtsensors/qsensorgesture-members.html
  12109. share/doc/qt5/qtsensors/qsensorgesture-obsolete.html
  12110. share/doc/qt5/qtsensors/qsensorgesture.html
  12111. share/doc/qt5/qtsensors/qsensorgesturemanager-members.html
  12112. share/doc/qt5/qtsensors/qsensorgesturemanager-obsolete.html
  12113. share/doc/qt5/qtsensors/qsensorgesturemanager.html
  12114. share/doc/qt5/qtsensors/qsensorgestureplugininterface-members.html
  12115. share/doc/qt5/qtsensors/qsensorgestureplugininterface.html
  12116. share/doc/qt5/qtsensors/qsensorgesturerecognizer-members.html
  12117. share/doc/qt5/qtsensors/qsensorgesturerecognizer-obsolete.html
  12118. share/doc/qt5/qtsensors/qsensorgesturerecognizer.html
  12119. share/doc/qt5/qtsensors/qsensormanager-members.html
  12120. share/doc/qt5/qtsensors/qsensormanager.html
  12121. share/doc/qt5/qtsensors/qsensorplugininterface-members.html
  12122. share/doc/qt5/qtsensors/qsensorplugininterface.html
  12123. share/doc/qt5/qtsensors/qsensorreading-members.html
  12124. share/doc/qt5/qtsensors/qsensorreading-obsolete.html
  12125. share/doc/qt5/qtsensors/qsensorreading.html
  12126. share/doc/qt5/qtsensors/qtapfilter-members.html
  12127. share/doc/qt5/qtsensors/qtapfilter.html
  12128. share/doc/qt5/qtsensors/qtapreading-members.html
  12129. share/doc/qt5/qtsensors/qtapreading-obsolete.html
  12130. share/doc/qt5/qtsensors/qtapreading.html
  12131. share/doc/qt5/qtsensors/qtapsensor-members.html
  12132. share/doc/qt5/qtsensors/qtapsensor-obsolete.html
  12133. share/doc/qt5/qtsensors/qtapsensor.html
  12134. share/doc/qt5/qtsensors/qtiltfilter-members.html
  12135. share/doc/qt5/qtsensors/qtiltfilter.html
  12136. share/doc/qt5/qtsensors/qtiltreading-members.html
  12137. share/doc/qt5/qtsensors/qtiltreading-obsolete.html
  12138. share/doc/qt5/qtsensors/qtiltreading.html
  12139. share/doc/qt5/qtsensors/qtiltsensor-members.html
  12140. share/doc/qt5/qtsensors/qtiltsensor-obsolete.html
  12141. share/doc/qt5/qtsensors/qtiltsensor.html
  12142. share/doc/qt5/qtsensors/qtsensorgestures-cpp.html
  12143. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-pro.html
  12144. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qml.html
  12145. share/doc/qt5/qtsensors/qtsensors-accelbubble-accelbubble-qrc.html
  12146. share/doc/qt5/qtsensors/qtsensors-accelbubble-android-androidmanifest-xml.html
  12147. share/doc/qt5/qtsensors/qtsensors-accelbubble-content-bluebubble-svg.html
  12148. share/doc/qt5/qtsensors/qtsensors-accelbubble-example.html
  12149. share/doc/qt5/qtsensors/qtsensors-accelbubble-main-cpp.html
  12150. share/doc/qt5/qtsensors/qtsensors-cpp.html
  12151. share/doc/qt5/qtsensors/qtsensors-examples.html
  12152. share/doc/qt5/qtsensors/qtsensors-grue-console-app-console-app-pro.html
  12153. share/doc/qt5/qtsensors/qtsensors-grue-example.html
  12154. share/doc/qt5/qtsensors/qtsensors-grue-grue-pro.html
  12155. share/doc/qt5/qtsensors/qtsensors-grue-grue-qml.html
  12156. share/doc/qt5/qtsensors/qtsensors-grue-import-import-pro.html
  12157. share/doc/qt5/qtsensors/qtsensors-grue-import-qmldir.html
  12158. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-cpp.html
  12159. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-h.html
  12160. share/doc/qt5/qtsensors/qtsensors-grue-lib-gruesensor-p-h.html
  12161. share/doc/qt5/qtsensors/qtsensors-grue-lib-lib-pro.html
  12162. share/doc/qt5/qtsensors/qtsensors-grue-main-cpp.html
  12163. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-cpp.html
  12164. share/doc/qt5/qtsensors/qtsensors-grue-plugin-gruesensorimpl-h.html
  12165. share/doc/qt5/qtsensors/qtsensors-grue-plugin-plugin-pro.html
  12166. share/doc/qt5/qtsensors/qtsensors-grue-qml-pro.html
  12167. share/doc/qt5/qtsensors/qtsensors-grue-qml-qrc.html
  12168. share/doc/qt5/qtsensors/qtsensors-index.html
  12169. share/doc/qt5/qtsensors/qtsensors-maze-android-androidmanifest-xml.html
  12170. share/doc/qt5/qtsensors/qtsensors-maze-components-applicationwindow-qml.html
  12171. share/doc/qt5/qtsensors/qtsensors-maze-components-button-qml.html
  12172. share/doc/qt5/qtsensors/qtsensors-maze-congratulation-qml.html
  12173. share/doc/qt5/qtsensors/qtsensors-maze-example.html
  12174. share/doc/qt5/qtsensors/qtsensors-maze-labyrinthsquare-qml.html
  12175. share/doc/qt5/qtsensors/qtsensors-maze-lib-js.html
  12176. share/doc/qt5/qtsensors/qtsensors-maze-main-cpp.html
  12177. share/doc/qt5/qtsensors/qtsensors-maze-maze-pro.html
  12178. share/doc/qt5/qtsensors/qtsensors-maze-maze-qml.html
  12179. share/doc/qt5/qtsensors/qtsensors-maze-maze-qrc.html
  12180. share/doc/qt5/qtsensors/qtsensors-maze-mouse-qml.html
  12181. share/doc/qt5/qtsensors/qtsensors-module.html
  12182. share/doc/qt5/qtsensors/qtsensors-porting.html
  12183. share/doc/qt5/qtsensors/qtsensors-qmlmodule.html
  12184. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-applicationwindow-qml.html
  12185. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-button-qml.html
  12186. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-components-divider-qml.html
  12187. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-example.html
  12188. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-main-cpp.html
  12189. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-pro.html
  12190. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qml.html
  12191. share/doc/qt5/qtsensors/qtsensors-qmlqtsensors-qmlqtsensors-qrc.html
  12192. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-button-qml.html
  12193. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-example.html
  12194. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturelist-qml.html
  12195. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gesturesview-qml.html
  12196. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-gestureview-qml.html
  12197. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-main-cpp.html
  12198. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-plugin-pro.html
  12199. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-cpp.html
  12200. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcountergestureplugin-h.html
  12201. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-cpp.html
  12202. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-plugin-qcounterrecognizer-h.html
  12203. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-pro.html
  12204. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qml-qrc.html
  12205. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-pro.html
  12206. share/doc/qt5/qtsensors/qtsensors-qmlsensorgestures-qmlsensorgestures-qml.html
  12207. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-example.html
  12208. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-cpp.html
  12209. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-explorer-h.html
  12210. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-import-pro.html
  12211. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-cpp.html
  12212. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-propertyinfo-h.html
  12213. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-qmldir.html
  12214. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-cpp.html
  12215. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-import-sensoritem-h.html
  12216. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-main-cpp.html
  12217. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-pro.html
  12218. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-qml-qrc.html
  12219. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-pro.html
  12220. share/doc/qt5/qtsensors/qtsensors-sensor-explorer-sensor-explorer-qml.html
  12221. share/doc/qt5/qtsensors/qtsensors-sensorgestures-example.html
  12222. share/doc/qt5/qtsensors/qtsensors-sensorgestures-main-cpp.html
  12223. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-cpp.html
  12224. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-h.html
  12225. share/doc/qt5/qtsensors/qtsensors-sensorgestures-mainwindow-ui.html
  12226. share/doc/qt5/qtsensors/qtsensors-sensorgestures-sensorgestures-pro.html
  12227. share/doc/qt5/qtsensors/qtsensors-shakeit-example.html
  12228. share/doc/qt5/qtsensors/qtsensors-shakeit-main-cpp.html
  12229. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-pro.html
  12230. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qml.html
  12231. share/doc/qt5/qtsensors/qtsensors-shakeit-shakeit-qrc.html
  12232. share/doc/qt5/qtsensors/qtsensors.index
  12233. share/doc/qt5/qtsensors/qtsensors.qhp
  12234. share/doc/qt5/qtsensors/qtsensors.qhp.sha1
  12235. share/doc/qt5/qtsensors/qtsensors.tags
  12236. share/doc/qt5/qtsensors/senorfwbackend.html
  12237. share/doc/qt5/qtsensors/sensorgesture-emulator-topics.html
  12238. share/doc/qt5/qtsensors/sensorgesture-plugins-topics.html
  12239. share/doc/qt5/qtsensors/sensors-backend-topics.html
  12240. share/doc/qt5/qtsensors/style/offline-simple.css
  12241. share/doc/qt5/qtsensors/style/offline.css
  12242. share/doc/qt5/qtserialbus.qch
  12243. share/doc/qt5/qtserialbus/examples-manifest.xml
  12244. share/doc/qt5/qtserialbus/images/arrow_bc.png
  12245. share/doc/qt5/qtserialbus/images/bgrContent.png
  12246. share/doc/qt5/qtserialbus/images/btn_next.png
  12247. share/doc/qt5/qtserialbus/images/btn_prev.png
  12248. share/doc/qt5/qtserialbus/images/bullet_dn.png
  12249. share/doc/qt5/qtserialbus/images/bullet_sq.png
  12250. share/doc/qt5/qtserialbus/images/can-example.png
  12251. share/doc/qt5/qtserialbus/images/home.png
  12252. share/doc/qt5/qtserialbus/images/ico_note.png
  12253. share/doc/qt5/qtserialbus/images/ico_note_attention.png
  12254. share/doc/qt5/qtserialbus/images/ico_out.png
  12255. share/doc/qt5/qtserialbus/images/logo.png
  12256. share/doc/qt5/qtserialbus/images/modbusmaster.png
  12257. share/doc/qt5/qtserialbus/images/modbusserver.png
  12258. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/application-exit.png
  12259. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/clear.png
  12260. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/connect.png
  12261. share/doc/qt5/qtserialbus/images/used-in-examples/can/images/disconnect.png
  12262. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/application-exit.png
  12263. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/connect.png
  12264. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/disconnect.png
  12265. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/master/images/settings.png
  12266. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/application-exit.png
  12267. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/connect.png
  12268. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/disconnect.png
  12269. share/doc/qt5/qtserialbus/images/used-in-examples/modbus/slave/images/settings.png
  12270. share/doc/qt5/qtserialbus/qcanbus-members.html
  12271. share/doc/qt5/qtserialbus/qcanbus-obsolete.html
  12272. share/doc/qt5/qtserialbus/qcanbus.html
  12273. share/doc/qt5/qtserialbus/qcanbusdevice-filter-members.html
  12274. share/doc/qt5/qtserialbus/qcanbusdevice-filter.html
  12275. share/doc/qt5/qtserialbus/qcanbusdevice-members.html
  12276. share/doc/qt5/qtserialbus/qcanbusdevice-obsolete.html
  12277. share/doc/qt5/qtserialbus/qcanbusdevice.html
  12278. share/doc/qt5/qtserialbus/qcanbusdeviceinfo-members.html
  12279. share/doc/qt5/qtserialbus/qcanbusdeviceinfo.html
  12280. share/doc/qt5/qtserialbus/qcanbusfactory-members.html
  12281. share/doc/qt5/qtserialbus/qcanbusfactory.html
  12282. share/doc/qt5/qtserialbus/qcanbusfactoryv2-members.html
  12283. share/doc/qt5/qtserialbus/qcanbusfactoryv2.html
  12284. share/doc/qt5/qtserialbus/qcanbusframe-members.html
  12285. share/doc/qt5/qtserialbus/qcanbusframe-timestamp-members.html
  12286. share/doc/qt5/qtserialbus/qcanbusframe-timestamp.html
  12287. share/doc/qt5/qtserialbus/qcanbusframe.html
  12288. share/doc/qt5/qtserialbus/qmodbusclient-members.html
  12289. share/doc/qt5/qtserialbus/qmodbusclient-obsolete.html
  12290. share/doc/qt5/qtserialbus/qmodbusclient.html
  12291. share/doc/qt5/qtserialbus/qmodbusdataunit-members.html
  12292. share/doc/qt5/qtserialbus/qmodbusdataunit.html
  12293. share/doc/qt5/qtserialbus/qmodbusdevice-members.html
  12294. share/doc/qt5/qtserialbus/qmodbusdevice-obsolete.html
  12295. share/doc/qt5/qtserialbus/qmodbusdevice.html
  12296. share/doc/qt5/qtserialbus/qmodbusdeviceidentification-members.html
  12297. share/doc/qt5/qtserialbus/qmodbusdeviceidentification.html
  12298. share/doc/qt5/qtserialbus/qmodbusexceptionresponse-members.html
  12299. share/doc/qt5/qtserialbus/qmodbusexceptionresponse.html
  12300. share/doc/qt5/qtserialbus/qmodbuspdu-members.html
  12301. share/doc/qt5/qtserialbus/qmodbuspdu.html
  12302. share/doc/qt5/qtserialbus/qmodbusreply-members.html
  12303. share/doc/qt5/qtserialbus/qmodbusreply-obsolete.html
  12304. share/doc/qt5/qtserialbus/qmodbusreply.html
  12305. share/doc/qt5/qtserialbus/qmodbusrequest-members.html
  12306. share/doc/qt5/qtserialbus/qmodbusrequest.html
  12307. share/doc/qt5/qtserialbus/qmodbusresponse-members.html
  12308. share/doc/qt5/qtserialbus/qmodbusresponse.html
  12309. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster-members.html
  12310. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster-obsolete.html
  12311. share/doc/qt5/qtserialbus/qmodbusrtuserialmaster.html
  12312. share/doc/qt5/qtserialbus/qmodbusrtuserialslave-members.html
  12313. share/doc/qt5/qtserialbus/qmodbusrtuserialslave-obsolete.html
  12314. share/doc/qt5/qtserialbus/qmodbusrtuserialslave.html
  12315. share/doc/qt5/qtserialbus/qmodbusserver-members.html
  12316. share/doc/qt5/qtserialbus/qmodbusserver-obsolete.html
  12317. share/doc/qt5/qtserialbus/qmodbusserver.html
  12318. share/doc/qt5/qtserialbus/qmodbustcpclient-members.html
  12319. share/doc/qt5/qtserialbus/qmodbustcpclient-obsolete.html
  12320. share/doc/qt5/qtserialbus/qmodbustcpclient.html
  12321. share/doc/qt5/qtserialbus/qmodbustcpserver-members.html
  12322. share/doc/qt5/qtserialbus/qmodbustcpserver-obsolete.html
  12323. share/doc/qt5/qtserialbus/qmodbustcpserver.html
  12324. share/doc/qt5/qtserialbus/qtcanbus-backends.html
  12325. share/doc/qt5/qtserialbus/qtmodbus-backends.html
  12326. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-cpp.html
  12327. share/doc/qt5/qtserialbus/qtserialbus-can-bitratebox-h.html
  12328. share/doc/qt5/qtserialbus/qtserialbus-can-can-pro.html
  12329. share/doc/qt5/qtserialbus/qtserialbus-can-can-qrc.html
  12330. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-cpp.html
  12331. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-h.html
  12332. share/doc/qt5/qtserialbus/qtserialbus-can-connectdialog-ui.html
  12333. share/doc/qt5/qtserialbus/qtserialbus-can-example.html
  12334. share/doc/qt5/qtserialbus/qtserialbus-can-main-cpp.html
  12335. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-cpp.html
  12336. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-h.html
  12337. share/doc/qt5/qtserialbus/qtserialbus-can-mainwindow-ui.html
  12338. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-cpp.html
  12339. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-h.html
  12340. share/doc/qt5/qtserialbus/qtserialbus-can-sendframebox-ui.html
  12341. share/doc/qt5/qtserialbus/qtserialbus-examples.html
  12342. share/doc/qt5/qtserialbus/qtserialbus-index.html
  12343. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-example.html
  12344. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-main-cpp.html
  12345. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-cpp.html
  12346. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-h.html
  12347. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-mainwindow-ui.html
  12348. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-pro.html
  12349. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-master-qrc.html
  12350. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-cpp.html
  12351. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-h.html
  12352. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-settingsdialog-ui.html
  12353. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-cpp.html
  12354. share/doc/qt5/qtserialbus/qtserialbus-modbus-master-writeregistermodel-h.html
  12355. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-example.html
  12356. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-main-cpp.html
  12357. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-cpp.html
  12358. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-h.html
  12359. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-mainwindow-ui.html
  12360. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-cpp.html
  12361. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-h.html
  12362. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-settingsdialog-ui.html
  12363. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-pro.html
  12364. share/doc/qt5/qtserialbus/qtserialbus-modbus-slave-slave-qrc.html
  12365. share/doc/qt5/qtserialbus/qtserialbus-module.html
  12366. share/doc/qt5/qtserialbus/qtserialbus-passthrucan-overview.html
  12367. share/doc/qt5/qtserialbus/qtserialbus-peakcan-overview.html
  12368. share/doc/qt5/qtserialbus/qtserialbus-socketcan-overview.html
  12369. share/doc/qt5/qtserialbus/qtserialbus-systeccan-overview.html
  12370. share/doc/qt5/qtserialbus/qtserialbus-tinycan-overview.html
  12371. share/doc/qt5/qtserialbus/qtserialbus-vectorcan-overview.html
  12372. share/doc/qt5/qtserialbus/qtserialbus-virtualcan-overview.html
  12373. share/doc/qt5/qtserialbus/qtserialbus.index
  12374. share/doc/qt5/qtserialbus/qtserialbus.qhp
  12375. share/doc/qt5/qtserialbus/qtserialbus.qhp.sha1
  12376. share/doc/qt5/qtserialbus/qtserialbus.tags
  12377. share/doc/qt5/qtserialbus/style/offline-simple.css
  12378. share/doc/qt5/qtserialbus/style/offline.css
  12379. share/doc/qt5/qtserialport.qch
  12380. share/doc/qt5/qtserialport/examples-manifest.xml
  12381. share/doc/qt5/qtserialport/images/arrow_bc.png
  12382. share/doc/qt5/qtserialport/images/bgrContent.png
  12383. share/doc/qt5/qtserialport/images/blockingmaster-example.png
  12384. share/doc/qt5/qtserialport/images/blockingslave-example.png
  12385. share/doc/qt5/qtserialport/images/btn_next.png
  12386. share/doc/qt5/qtserialport/images/btn_prev.png
  12387. share/doc/qt5/qtserialport/images/bullet_dn.png
  12388. share/doc/qt5/qtserialport/images/bullet_sq.png
  12389. share/doc/qt5/qtserialport/images/cenumerator-example.png
  12390. share/doc/qt5/qtserialport/images/creaderasync-example.png
  12391. share/doc/qt5/qtserialport/images/creadersync-example.png
  12392. share/doc/qt5/qtserialport/images/cwriterasync-example.png
  12393. share/doc/qt5/qtserialport/images/cwritersync-example.png
  12394. share/doc/qt5/qtserialport/images/enumerator-example.png
  12395. share/doc/qt5/qtserialport/images/home.png
  12396. share/doc/qt5/qtserialport/images/ico_note.png
  12397. share/doc/qt5/qtserialport/images/ico_note_attention.png
  12398. share/doc/qt5/qtserialport/images/ico_out.png
  12399. share/doc/qt5/qtserialport/images/logo.png
  12400. share/doc/qt5/qtserialport/images/terminal-example.png
  12401. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/application-exit.png
  12402. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/clear.png
  12403. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/connect.png
  12404. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/disconnect.png
  12405. share/doc/qt5/qtserialport/images/used-in-examples/terminal/images/settings.png
  12406. share/doc/qt5/qtserialport/qserialport-members.html
  12407. share/doc/qt5/qtserialport/qserialport-obsolete.html
  12408. share/doc/qt5/qtserialport/qserialport.html
  12409. share/doc/qt5/qtserialport/qserialportinfo-members.html
  12410. share/doc/qt5/qtserialport/qserialportinfo-obsolete.html
  12411. share/doc/qt5/qtserialport/qserialportinfo.html
  12412. share/doc/qt5/qtserialport/qtserialport-blockingmaster-blockingmaster-pro.html
  12413. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-cpp.html
  12414. share/doc/qt5/qtserialport/qtserialport-blockingmaster-dialog-h.html
  12415. share/doc/qt5/qtserialport/qtserialport-blockingmaster-example.html
  12416. share/doc/qt5/qtserialport/qtserialport-blockingmaster-main-cpp.html
  12417. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-cpp.html
  12418. share/doc/qt5/qtserialport/qtserialport-blockingmaster-masterthread-h.html
  12419. share/doc/qt5/qtserialport/qtserialport-blockingslave-blockingslave-pro.html
  12420. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-cpp.html
  12421. share/doc/qt5/qtserialport/qtserialport-blockingslave-dialog-h.html
  12422. share/doc/qt5/qtserialport/qtserialport-blockingslave-example.html
  12423. share/doc/qt5/qtserialport/qtserialport-blockingslave-main-cpp.html
  12424. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-cpp.html
  12425. share/doc/qt5/qtserialport/qtserialport-blockingslave-slavethread-h.html
  12426. share/doc/qt5/qtserialport/qtserialport-cenumerator-cenumerator-pro.html
  12427. share/doc/qt5/qtserialport/qtserialport-cenumerator-example.html
  12428. share/doc/qt5/qtserialport/qtserialport-cenumerator-main-cpp.html
  12429. share/doc/qt5/qtserialport/qtserialport-creaderasync-creaderasync-pro.html
  12430. share/doc/qt5/qtserialport/qtserialport-creaderasync-example.html
  12431. share/doc/qt5/qtserialport/qtserialport-creaderasync-main-cpp.html
  12432. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-cpp.html
  12433. share/doc/qt5/qtserialport/qtserialport-creaderasync-serialportreader-h.html
  12434. share/doc/qt5/qtserialport/qtserialport-creadersync-creadersync-pro.html
  12435. share/doc/qt5/qtserialport/qtserialport-creadersync-example.html
  12436. share/doc/qt5/qtserialport/qtserialport-creadersync-main-cpp.html
  12437. share/doc/qt5/qtserialport/qtserialport-cwriterasync-cwriterasync-pro.html
  12438. share/doc/qt5/qtserialport/qtserialport-cwriterasync-example.html
  12439. share/doc/qt5/qtserialport/qtserialport-cwriterasync-main-cpp.html
  12440. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-cpp.html
  12441. share/doc/qt5/qtserialport/qtserialport-cwriterasync-serialportwriter-h.html
  12442. share/doc/qt5/qtserialport/qtserialport-cwritersync-cwritersync-pro.html
  12443. share/doc/qt5/qtserialport/qtserialport-cwritersync-example.html
  12444. share/doc/qt5/qtserialport/qtserialport-cwritersync-main-cpp.html
  12445. share/doc/qt5/qtserialport/qtserialport-enumerator-enumerator-pro.html
  12446. share/doc/qt5/qtserialport/qtserialport-enumerator-example.html
  12447. share/doc/qt5/qtserialport/qtserialport-enumerator-main-cpp.html
  12448. share/doc/qt5/qtserialport/qtserialport-examples.html
  12449. share/doc/qt5/qtserialport/qtserialport-index.html
  12450. share/doc/qt5/qtserialport/qtserialport-module.html
  12451. share/doc/qt5/qtserialport/qtserialport-terminal-console-cpp.html
  12452. share/doc/qt5/qtserialport/qtserialport-terminal-console-h.html
  12453. share/doc/qt5/qtserialport/qtserialport-terminal-example.html
  12454. share/doc/qt5/qtserialport/qtserialport-terminal-main-cpp.html
  12455. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-cpp.html
  12456. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-h.html
  12457. share/doc/qt5/qtserialport/qtserialport-terminal-mainwindow-ui.html
  12458. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-cpp.html
  12459. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-h.html
  12460. share/doc/qt5/qtserialport/qtserialport-terminal-settingsdialog-ui.html
  12461. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-pro.html
  12462. share/doc/qt5/qtserialport/qtserialport-terminal-terminal-qrc.html
  12463. share/doc/qt5/qtserialport/qtserialport.index
  12464. share/doc/qt5/qtserialport/qtserialport.qhp
  12465. share/doc/qt5/qtserialport/qtserialport.qhp.sha1
  12466. share/doc/qt5/qtserialport/style/offline-simple.css
  12467. share/doc/qt5/qtserialport/style/offline.css
  12468. share/doc/qt5/qtspeech.qch
  12469. share/doc/qt5/qtspeech/examples-manifest.xml
  12470. share/doc/qt5/qtspeech/images/arrow_bc.png
  12471. share/doc/qt5/qtspeech/images/bgrContent.png
  12472. share/doc/qt5/qtspeech/images/btn_next.png
  12473. share/doc/qt5/qtspeech/images/btn_prev.png
  12474. share/doc/qt5/qtspeech/images/bullet_dn.png
  12475. share/doc/qt5/qtspeech/images/bullet_sq.png
  12476. share/doc/qt5/qtspeech/images/hellospeak-example.png
  12477. share/doc/qt5/qtspeech/images/home.png
  12478. share/doc/qt5/qtspeech/images/ico_note.png
  12479. share/doc/qt5/qtspeech/images/ico_note_attention.png
  12480. share/doc/qt5/qtspeech/images/ico_out.png
  12481. share/doc/qt5/qtspeech/images/logo.png
  12482. share/doc/qt5/qtspeech/qtexttospeech-members.html
  12483. share/doc/qt5/qtspeech/qtexttospeech-obsolete.html
  12484. share/doc/qt5/qtspeech/qtexttospeech.html
  12485. share/doc/qt5/qtspeech/qtexttospeechengine-members.html
  12486. share/doc/qt5/qtspeech/qtexttospeechengine-obsolete.html
  12487. share/doc/qt5/qtspeech/qtexttospeechengine.html
  12488. share/doc/qt5/qtspeech/qtexttospeechplugin-members.html
  12489. share/doc/qt5/qtspeech/qtexttospeechplugin.html
  12490. share/doc/qt5/qtspeech/qtspeech-hello-speak-example.html
  12491. share/doc/qt5/qtspeech/qtspeech-hello-speak-hello-speak-pro.html
  12492. share/doc/qt5/qtspeech/qtspeech-hello-speak-main-cpp.html
  12493. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-cpp.html
  12494. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-h.html
  12495. share/doc/qt5/qtspeech/qtspeech-hello-speak-mainwindow-ui.html
  12496. share/doc/qt5/qtspeech/qtspeech-index.html
  12497. share/doc/qt5/qtspeech/qtspeech-module.html
  12498. share/doc/qt5/qtspeech/qtspeech.index
  12499. share/doc/qt5/qtspeech/qtspeech.qhp
  12500. share/doc/qt5/qtspeech/qtspeech.qhp.sha1
  12501. share/doc/qt5/qtspeech/qtspeech.tags
  12502. share/doc/qt5/qtspeech/qvoice-members.html
  12503. share/doc/qt5/qtspeech/qvoice.html
  12504. share/doc/qt5/qtspeech/style/offline-simple.css
  12505. share/doc/qt5/qtspeech/style/offline.css
  12506. share/doc/qt5/qtsql.qch
  12507. share/doc/qt5/qtsql/database.html
  12508. share/doc/qt5/qtsql/examples-manifest.xml
  12509. share/doc/qt5/qtsql/images/arrow_bc.png
  12510. share/doc/qt5/qtsql/images/bgrContent.png
  12511. share/doc/qt5/qtsql/images/books-demo.png
  12512. share/doc/qt5/qtsql/images/btn_next.png
  12513. share/doc/qt5/qtsql/images/btn_prev.png
  12514. share/doc/qt5/qtsql/images/bullet_dn.png
  12515. share/doc/qt5/qtsql/images/bullet_sq.png
  12516. share/doc/qt5/qtsql/images/cachedtable-example.png
  12517. share/doc/qt5/qtsql/images/drilldown-example.png
  12518. share/doc/qt5/qtsql/images/foreignkeys.png
  12519. share/doc/qt5/qtsql/images/home.png
  12520. share/doc/qt5/qtsql/images/ico_note.png
  12521. share/doc/qt5/qtsql/images/ico_note_attention.png
  12522. share/doc/qt5/qtsql/images/ico_out.png
  12523. share/doc/qt5/qtsql/images/insertrowinmodelview.png
  12524. share/doc/qt5/qtsql/images/logo.png
  12525. share/doc/qt5/qtsql/images/masterdetail-example.png
  12526. share/doc/qt5/qtsql/images/noforeignkeys.png
  12527. share/doc/qt5/qtsql/images/qdatawidgetmapper-simple.png
  12528. share/doc/qt5/qtsql/images/querymodel-example.png
  12529. share/doc/qt5/qtsql/images/relationaltable.png
  12530. share/doc/qt5/qtsql/images/relationaltablemodel-example.png
  12531. share/doc/qt5/qtsql/images/sql-widget-mapper.png
  12532. share/doc/qt5/qtsql/images/sqlbrowser-demo.png
  12533. share/doc/qt5/qtsql/images/tablemodel-example.png
  12534. share/doc/qt5/qtsql/images/used-in-examples/books/images/star.png
  12535. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-creator.png
  12536. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-logo.png
  12537. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-project.png
  12538. share/doc/qt5/qtsql/images/used-in-examples/drilldown/images/qt-quick.png
  12539. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/icon.png
  12540. share/doc/qt5/qtsql/images/used-in-examples/masterdetail/images/image.png
  12541. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping-table.png
  12542. share/doc/qt5/qtsql/images/widgetmapper-sql-mapping.png
  12543. share/doc/qt5/qtsql/qsql.html
  12544. share/doc/qt5/qtsql/qsqldatabase-members.html
  12545. share/doc/qt5/qtsql/qsqldatabase.html
  12546. share/doc/qt5/qtsql/qsqldriver-members.html
  12547. share/doc/qt5/qtsql/qsqldriver-obsolete.html
  12548. share/doc/qt5/qtsql/qsqldriver.html
  12549. share/doc/qt5/qtsql/qsqldrivercreator-members.html
  12550. share/doc/qt5/qtsql/qsqldrivercreator.html
  12551. share/doc/qt5/qtsql/qsqldrivercreatorbase-members.html
  12552. share/doc/qt5/qtsql/qsqldrivercreatorbase.html
  12553. share/doc/qt5/qtsql/qsqldriverplugin-members.html
  12554. share/doc/qt5/qtsql/qsqldriverplugin-obsolete.html
  12555. share/doc/qt5/qtsql/qsqldriverplugin.html
  12556. share/doc/qt5/qtsql/qsqlerror-members.html
  12557. share/doc/qt5/qtsql/qsqlerror-obsolete.html
  12558. share/doc/qt5/qtsql/qsqlerror.html
  12559. share/doc/qt5/qtsql/qsqlfield-members.html
  12560. share/doc/qt5/qtsql/qsqlfield.html
  12561. share/doc/qt5/qtsql/qsqlindex-members.html
  12562. share/doc/qt5/qtsql/qsqlindex.html
  12563. share/doc/qt5/qtsql/qsqlquery-members.html
  12564. share/doc/qt5/qtsql/qsqlquery.html
  12565. share/doc/qt5/qtsql/qsqlquerymodel-members.html
  12566. share/doc/qt5/qtsql/qsqlquerymodel-obsolete.html
  12567. share/doc/qt5/qtsql/qsqlquerymodel.html
  12568. share/doc/qt5/qtsql/qsqlrecord-members.html
  12569. share/doc/qt5/qtsql/qsqlrecord.html
  12570. share/doc/qt5/qtsql/qsqlrelation-members.html
  12571. share/doc/qt5/qtsql/qsqlrelation.html
  12572. share/doc/qt5/qtsql/qsqlrelationaldelegate-members.html
  12573. share/doc/qt5/qtsql/qsqlrelationaldelegate-obsolete.html
  12574. share/doc/qt5/qtsql/qsqlrelationaldelegate.html
  12575. share/doc/qt5/qtsql/qsqlrelationaltablemodel-members.html
  12576. share/doc/qt5/qtsql/qsqlrelationaltablemodel-obsolete.html
  12577. share/doc/qt5/qtsql/qsqlrelationaltablemodel.html
  12578. share/doc/qt5/qtsql/qsqlresult-members.html
  12579. share/doc/qt5/qtsql/qsqlresult.html
  12580. share/doc/qt5/qtsql/qsqltablemodel-members.html
  12581. share/doc/qt5/qtsql/qsqltablemodel-obsolete.html
  12582. share/doc/qt5/qtsql/qsqltablemodel.html
  12583. share/doc/qt5/qtsql/qtsql-attribution-sqlite.html
  12584. share/doc/qt5/qtsql/qtsql-books-bookdelegate-cpp.html
  12585. share/doc/qt5/qtsql/qtsql-books-bookdelegate-h.html
  12586. share/doc/qt5/qtsql/qtsql-books-books-pro.html
  12587. share/doc/qt5/qtsql/qtsql-books-books-qrc.html
  12588. share/doc/qt5/qtsql/qtsql-books-bookwindow-cpp.html
  12589. share/doc/qt5/qtsql/qtsql-books-bookwindow-h.html
  12590. share/doc/qt5/qtsql/qtsql-books-bookwindow-ui.html
  12591. share/doc/qt5/qtsql/qtsql-books-example.html
  12592. share/doc/qt5/qtsql/qtsql-books-initdb-h.html
  12593. share/doc/qt5/qtsql/qtsql-books-main-cpp.html
  12594. share/doc/qt5/qtsql/qtsql-cachedtable-cachedtable-pro.html
  12595. share/doc/qt5/qtsql/qtsql-cachedtable-example.html
  12596. share/doc/qt5/qtsql/qtsql-cachedtable-main-cpp.html
  12597. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-cpp.html
  12598. share/doc/qt5/qtsql/qtsql-cachedtable-tableeditor-h.html
  12599. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-pro.html
  12600. share/doc/qt5/qtsql/qtsql-drilldown-drilldown-qrc.html
  12601. share/doc/qt5/qtsql/qtsql-drilldown-example.html
  12602. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-cpp.html
  12603. share/doc/qt5/qtsql/qtsql-drilldown-imageitem-h.html
  12604. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-cpp.html
  12605. share/doc/qt5/qtsql/qtsql-drilldown-informationwindow-h.html
  12606. share/doc/qt5/qtsql/qtsql-drilldown-main-cpp.html
  12607. share/doc/qt5/qtsql/qtsql-drilldown-view-cpp.html
  12608. share/doc/qt5/qtsql/qtsql-drilldown-view-h.html
  12609. share/doc/qt5/qtsql/qtsql-index.html
  12610. share/doc/qt5/qtsql/qtsql-masterdetail-albumdetails-xml.html
  12611. share/doc/qt5/qtsql/qtsql-masterdetail-database-h.html
  12612. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-cpp.html
  12613. share/doc/qt5/qtsql/qtsql-masterdetail-dialog-h.html
  12614. share/doc/qt5/qtsql/qtsql-masterdetail-example.html
  12615. share/doc/qt5/qtsql/qtsql-masterdetail-main-cpp.html
  12616. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-cpp.html
  12617. share/doc/qt5/qtsql/qtsql-masterdetail-mainwindow-h.html
  12618. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-pro.html
  12619. share/doc/qt5/qtsql/qtsql-masterdetail-masterdetail-qrc.html
  12620. share/doc/qt5/qtsql/qtsql-module.html
  12621. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-cpp.html
  12622. share/doc/qt5/qtsql/qtsql-querymodel-customsqlmodel-h.html
  12623. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-cpp.html
  12624. share/doc/qt5/qtsql/qtsql-querymodel-editablesqlmodel-h.html
  12625. share/doc/qt5/qtsql/qtsql-querymodel-example.html
  12626. share/doc/qt5/qtsql/qtsql-querymodel-main-cpp.html
  12627. share/doc/qt5/qtsql/qtsql-querymodel-querymodel-pro.html
  12628. share/doc/qt5/qtsql/qtsql-relationaltablemodel-example.html
  12629. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-cpp.html
  12630. share/doc/qt5/qtsql/qtsql-relationaltablemodel-relationaltablemodel-pro.html
  12631. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-cpp.html
  12632. share/doc/qt5/qtsql/qtsql-sqlbrowser-browser-h.html
  12633. share/doc/qt5/qtsql/qtsql-sqlbrowser-browserwidget-ui.html
  12634. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-cpp.html
  12635. share/doc/qt5/qtsql/qtsql-sqlbrowser-connectionwidget-h.html
  12636. share/doc/qt5/qtsql/qtsql-sqlbrowser-example.html
  12637. share/doc/qt5/qtsql/qtsql-sqlbrowser-main-cpp.html
  12638. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-cpp.html
  12639. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-h.html
  12640. share/doc/qt5/qtsql/qtsql-sqlbrowser-qsqlconnectiondialog-ui.html
  12641. share/doc/qt5/qtsql/qtsql-sqlbrowser-sqlbrowser-pro.html
  12642. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-example.html
  12643. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-main-cpp.html
  12644. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-sqlwidgetmapper-pro.html
  12645. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-cpp.html
  12646. share/doc/qt5/qtsql/qtsql-sqlwidgetmapper-window-h.html
  12647. share/doc/qt5/qtsql/qtsql-tablemodel-example.html
  12648. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-cpp.html
  12649. share/doc/qt5/qtsql/qtsql-tablemodel-tablemodel-pro.html
  12650. share/doc/qt5/qtsql/qtsql.index
  12651. share/doc/qt5/qtsql/qtsql.qhp
  12652. share/doc/qt5/qtsql/qtsql.qhp.sha1
  12653. share/doc/qt5/qtsql/qtsql.tags
  12654. share/doc/qt5/qtsql/sql-connecting.html
  12655. share/doc/qt5/qtsql/sql-driver.html
  12656. share/doc/qt5/qtsql/sql-forms.html
  12657. share/doc/qt5/qtsql/sql-model.html
  12658. share/doc/qt5/qtsql/sql-presenting.html
  12659. share/doc/qt5/qtsql/sql-programming.html
  12660. share/doc/qt5/qtsql/sql-sqlstatements.html
  12661. share/doc/qt5/qtsql/sql-types.html
  12662. share/doc/qt5/qtsql/style/offline-simple.css
  12663. share/doc/qt5/qtsql/style/offline.css
  12664. share/doc/qt5/qtsvg.qch
  12665. share/doc/qt5/qtsvg/examples-manifest.xml
  12666. share/doc/qt5/qtsvg/images/arrow_bc.png
  12667. share/doc/qt5/qtsvg/images/bgrContent.png
  12668. share/doc/qt5/qtsvg/images/btn_next.png
  12669. share/doc/qt5/qtsvg/images/btn_prev.png
  12670. share/doc/qt5/qtsvg/images/bullet_dn.png
  12671. share/doc/qt5/qtsvg/images/bullet_sq.png
  12672. share/doc/qt5/qtsvg/images/home.png
  12673. share/doc/qt5/qtsvg/images/ico_note.png
  12674. share/doc/qt5/qtsvg/images/ico_note_attention.png
  12675. share/doc/qt5/qtsvg/images/ico_out.png
  12676. share/doc/qt5/qtsvg/images/logo.png
  12677. share/doc/qt5/qtsvg/images/svggenerator-example.png
  12678. share/doc/qt5/qtsvg/images/svgviewer-example.png
  12679. share/doc/qt5/qtsvg/images/textobject-example.png
  12680. share/doc/qt5/qtsvg/qgraphicssvgitem-members.html
  12681. share/doc/qt5/qtsvg/qgraphicssvgitem-obsolete.html
  12682. share/doc/qt5/qtsvg/qgraphicssvgitem.html
  12683. share/doc/qt5/qtsvg/qsvggenerator-members.html
  12684. share/doc/qt5/qtsvg/qsvggenerator.html
  12685. share/doc/qt5/qtsvg/qsvgrenderer-members.html
  12686. share/doc/qt5/qtsvg/qsvgrenderer-obsolete.html
  12687. share/doc/qt5/qtsvg/qsvgrenderer.html
  12688. share/doc/qt5/qtsvg/qsvgwidget-members.html
  12689. share/doc/qt5/qtsvg/qsvgwidget-obsolete.html
  12690. share/doc/qt5/qtsvg/qsvgwidget.html
  12691. share/doc/qt5/qtsvg/qtsvg-attribution-xsvg.html
  12692. share/doc/qt5/qtsvg/qtsvg-index.html
  12693. share/doc/qt5/qtsvg/qtsvg-module.html
  12694. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-example.html
  12695. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-files-heart-svg.html
  12696. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-main-cpp.html
  12697. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-resources-qrc.html
  12698. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-cpp.html
  12699. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-svgtextobject-h.html
  12700. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-textobject-pro.html
  12701. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-cpp.html
  12702. share/doc/qt5/qtsvg/qtsvg-richtext-textobject-window-h.html
  12703. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-cpp.html
  12704. share/doc/qt5/qtsvg/qtsvg-svggenerator-displaywidget-h.html
  12705. share/doc/qt5/qtsvg/qtsvg-svggenerator-example.html
  12706. share/doc/qt5/qtsvg/qtsvg-svggenerator-forms-window-ui.html
  12707. share/doc/qt5/qtsvg/qtsvg-svggenerator-main-cpp.html
  12708. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-pro.html
  12709. share/doc/qt5/qtsvg/qtsvg-svggenerator-svggenerator-qrc.html
  12710. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-cpp.html
  12711. share/doc/qt5/qtsvg/qtsvg-svggenerator-window-h.html
  12712. share/doc/qt5/qtsvg/qtsvg-svgviewer-example.html
  12713. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-cpp.html
  12714. share/doc/qt5/qtsvg/qtsvg-svgviewer-exportdialog-h.html
  12715. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-bubbles-svg.html
  12716. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-cubic-svg.html
  12717. share/doc/qt5/qtsvg/qtsvg-svgviewer-files-spheres-svg.html
  12718. share/doc/qt5/qtsvg/qtsvg-svgviewer-main-cpp.html
  12719. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-cpp.html
  12720. share/doc/qt5/qtsvg/qtsvg-svgviewer-mainwindow-h.html
  12721. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-cpp.html
  12722. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgview-h.html
  12723. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-pro.html
  12724. share/doc/qt5/qtsvg/qtsvg-svgviewer-svgviewer-qrc.html
  12725. share/doc/qt5/qtsvg/qtsvg.index
  12726. share/doc/qt5/qtsvg/qtsvg.qhp
  12727. share/doc/qt5/qtsvg/qtsvg.qhp.sha1
  12728. share/doc/qt5/qtsvg/qtsvg.tags
  12729. share/doc/qt5/qtsvg/style/offline-simple.css
  12730. share/doc/qt5/qtsvg/style/offline.css
  12731. share/doc/qt5/qtsvg/svgrendering.html
  12732. share/doc/qt5/qttestlib.qch
  12733. share/doc/qt5/qttestlib/examples-manifest.xml
  12734. share/doc/qt5/qttestlib/images/arrow_bc.png
  12735. share/doc/qt5/qttestlib/images/bgrContent.png
  12736. share/doc/qt5/qttestlib/images/btn_next.png
  12737. share/doc/qt5/qttestlib/images/btn_prev.png
  12738. share/doc/qt5/qttestlib/images/bullet_dn.png
  12739. share/doc/qt5/qttestlib/images/bullet_sq.png
  12740. share/doc/qt5/qttestlib/images/home.png
  12741. share/doc/qt5/qttestlib/images/ico_note.png
  12742. share/doc/qt5/qttestlib/images/ico_note_attention.png
  12743. share/doc/qt5/qttestlib/images/ico_out.png
  12744. share/doc/qt5/qttestlib/images/logo.png
  12745. share/doc/qt5/qttestlib/qabstractitemmodeltester-members.html
  12746. share/doc/qt5/qttestlib/qabstractitemmodeltester-obsolete.html
  12747. share/doc/qt5/qttestlib/qabstractitemmodeltester.html
  12748. share/doc/qt5/qttestlib/qsignalspy-members.html
  12749. share/doc/qt5/qttestlib/qsignalspy-obsolete.html
  12750. share/doc/qt5/qttestlib/qsignalspy.html
  12751. share/doc/qt5/qttestlib/qtest-obsolete.html
  12752. share/doc/qt5/qttestlib/qtest-overview.html
  12753. share/doc/qt5/qttestlib/qtest-qtoucheventsequence-members.html
  12754. share/doc/qt5/qttestlib/qtest-qtoucheventsequence.html
  12755. share/doc/qt5/qttestlib/qtest-tutorial.html
  12756. share/doc/qt5/qttestlib/qtest.html
  12757. share/doc/qt5/qttestlib/qtesteventlist-members.html
  12758. share/doc/qt5/qttestlib/qtesteventlist.html
  12759. share/doc/qt5/qttestlib/qttest-index.html
  12760. share/doc/qt5/qttestlib/qttest-module.html
  12761. share/doc/qt5/qttestlib/qttestlib-attribution-cycle.html
  12762. share/doc/qt5/qttestlib/qttestlib-attribution-linuxperf.html
  12763. share/doc/qt5/qttestlib/qttestlib-attribution-valgrind.html
  12764. share/doc/qt5/qttestlib/qttestlib-tutorial1-example.html
  12765. share/doc/qt5/qttestlib/qttestlib-tutorial1-testqstring-cpp.html
  12766. share/doc/qt5/qttestlib/qttestlib-tutorial1-tutorial1-pro.html
  12767. share/doc/qt5/qttestlib/qttestlib-tutorial2-example.html
  12768. share/doc/qt5/qttestlib/qttestlib-tutorial2-testqstring-cpp.html
  12769. share/doc/qt5/qttestlib/qttestlib-tutorial2-tutorial2-pro.html
  12770. share/doc/qt5/qttestlib/qttestlib-tutorial3-example.html
  12771. share/doc/qt5/qttestlib/qttestlib-tutorial3-testgui-cpp.html
  12772. share/doc/qt5/qttestlib/qttestlib-tutorial3-tutorial3-pro.html
  12773. share/doc/qt5/qttestlib/qttestlib-tutorial4-example.html
  12774. share/doc/qt5/qttestlib/qttestlib-tutorial4-testgui-cpp.html
  12775. share/doc/qt5/qttestlib/qttestlib-tutorial4-tutorial4-pro.html
  12776. share/doc/qt5/qttestlib/qttestlib-tutorial5-benchmarking-cpp.html
  12777. share/doc/qt5/qttestlib/qttestlib-tutorial5-example.html
  12778. share/doc/qt5/qttestlib/qttestlib-tutorial5-tutorial5-pro.html
  12779. share/doc/qt5/qttestlib/qttestlib-tutorial6.html
  12780. share/doc/qt5/qttestlib/qttestlib.index
  12781. share/doc/qt5/qttestlib/qttestlib.qhp
  12782. share/doc/qt5/qttestlib/qttestlib.qhp.sha1
  12783. share/doc/qt5/qttestlib/qttestlib.tags
  12784. share/doc/qt5/qttestlib/style/offline-simple.css
  12785. share/doc/qt5/qttestlib/style/offline.css
  12786. share/doc/qt5/qtuitools.qch
  12787. share/doc/qt5/qtuitools/examples-manifest.xml
  12788. share/doc/qt5/qtuitools/examples-qtuitools.html
  12789. share/doc/qt5/qtuitools/images/arrow_bc.png
  12790. share/doc/qt5/qtuitools/images/bgrContent.png
  12791. share/doc/qt5/qtuitools/images/btn_next.png
  12792. share/doc/qt5/qtuitools/images/btn_prev.png
  12793. share/doc/qt5/qtuitools/images/bullet_dn.png
  12794. share/doc/qt5/qtuitools/images/bullet_sq.png
  12795. share/doc/qt5/qtuitools/images/home.png
  12796. share/doc/qt5/qtuitools/images/ico_note.png
  12797. share/doc/qt5/qtuitools/images/ico_note_attention.png
  12798. share/doc/qt5/qtuitools/images/ico_out.png
  12799. share/doc/qt5/qtuitools/images/logo.png
  12800. share/doc/qt5/qtuitools/images/multipleinheritance-example.png
  12801. share/doc/qt5/qtuitools/images/textfinder-example-find.png
  12802. share/doc/qt5/qtuitools/images/textfinder-example-find2.png
  12803. share/doc/qt5/qtuitools/images/textfinder-example-userinterface.png
  12804. share/doc/qt5/qtuitools/images/uitools-examples.png
  12805. share/doc/qt5/qtuitools/qtuitools-index.html
  12806. share/doc/qt5/qtuitools/qtuitools-module.html
  12807. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-cpp.html
  12808. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-h.html
  12809. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-calculatorform-ui.html
  12810. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-example.html
  12811. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-main-cpp.html
  12812. share/doc/qt5/qtuitools/qtuitools-multipleinheritance-multipleinheritance-pro.html
  12813. share/doc/qt5/qtuitools/qtuitools-textfinder-example.html
  12814. share/doc/qt5/qtuitools/qtuitools-textfinder-forms-textfinder-ui.html
  12815. share/doc/qt5/qtuitools/qtuitools-textfinder-main-cpp.html
  12816. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-cpp.html
  12817. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-h.html
  12818. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-pro.html
  12819. share/doc/qt5/qtuitools/qtuitools-textfinder-textfinder-qrc.html
  12820. share/doc/qt5/qtuitools/qtuitools.index
  12821. share/doc/qt5/qtuitools/qtuitools.qhp
  12822. share/doc/qt5/qtuitools/qtuitools.qhp.sha1
  12823. share/doc/qt5/qtuitools/quiloader-members.html
  12824. share/doc/qt5/qtuitools/quiloader-obsolete.html
  12825. share/doc/qt5/qtuitools/quiloader.html
  12826. share/doc/qt5/qtuitools/style/offline-simple.css
  12827. share/doc/qt5/qtuitools/style/offline.css
  12828. share/doc/qt5/qtwaylandcompositor.qch
  12829. share/doc/qt5/qtwaylandcompositor/examples-manifest.xml
  12830. share/doc/qt5/qtwaylandcompositor/images/arrow_bc.png
  12831. share/doc/qt5/qtwaylandcompositor/images/bgrContent.png
  12832. share/doc/qt5/qtwaylandcompositor/images/btn_next.png
  12833. share/doc/qt5/qtwaylandcompositor/images/btn_prev.png
  12834. share/doc/qt5/qtwaylandcompositor/images/bullet_dn.png
  12835. share/doc/qt5/qtwaylandcompositor/images/bullet_sq.png
  12836. share/doc/qt5/qtwaylandcompositor/images/home.png
  12837. share/doc/qt5/qtwaylandcompositor/images/ico_note.png
  12838. share/doc/qt5/qtwaylandcompositor/images/ico_note_attention.png
  12839. share/doc/qt5/qtwaylandcompositor/images/ico_out.png
  12840. share/doc/qt5/qtwaylandcompositor/images/logo.png
  12841. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/multi-output/images/background.jpg
  12842. share/doc/qt5/qtwaylandcompositor/images/used-in-examples/pure-qml/images/background.jpg
  12843. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-members.html
  12844. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication.html
  12845. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface-members.html
  12846. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface.html
  12847. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface-members.html
  12848. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface.html
  12849. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem-members.html
  12850. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem.html
  12851. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient-members.html
  12852. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient.html
  12853. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor-members.html
  12854. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor.html
  12855. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer-members.html
  12856. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer.html
  12857. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput-members.html
  12858. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput.html
  12859. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem-members.html
  12860. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem.html
  12861. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat-members.html
  12862. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat.html
  12863. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-members.html
  12864. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface.html
  12865. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview-members.html
  12866. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-waylandview.html
  12867. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-members.html
  12868. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshell.html
  12869. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface-members.html
  12870. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface.html
  12871. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgdecorationmanagerv1-members.html
  12872. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgdecorationmanagerv1.html
  12873. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopup-members.html
  12874. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopup.html
  12875. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5-members.html
  12876. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5.html
  12877. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6-members.html
  12878. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6.html
  12879. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-members.html
  12880. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell.html
  12881. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5-members.html
  12882. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5.html
  12883. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6-members.html
  12884. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6.html
  12885. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurface-members.html
  12886. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurface.html
  12887. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5-members.html
  12888. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5.html
  12889. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6-members.html
  12890. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6.html
  12891. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevel-members.html
  12892. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevel.html
  12893. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6-members.html
  12894. share/doc/qt5/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6.html
  12895. share/doc/qt5/qtwaylandcompositor/qtwayland-compositor-qmlmodule.html
  12896. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-eglstream-controller.html
  12897. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-ivi-extension-protocol.html
  12898. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-protocol.html
  12899. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-txt-input-unstable.html
  12900. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-decoration-protocol.html
  12901. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-output-protocol.html
  12902. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-shell-protocol.html
  12903. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-examples.html
  12904. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-index.html
  12905. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-example.html
  12906. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-pro.html
  12907. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-ivi-compositor-qrc.html
  12908. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-cpp.html
  12909. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-main-qml.html
  12910. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-example.html
  12911. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-cpp.html
  12912. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-main-qml.html
  12913. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-pro.html
  12914. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-minimal-qml-qrc.html
  12915. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-module.html
  12916. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-example.html
  12917. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-main-cpp.html
  12918. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-pro.html
  12919. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-multi-output-qrc.html
  12920. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-gridscreen-qml.html
  12921. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-main-qml.html
  12922. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellchrome-qml.html
  12923. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-output-qml-shellscreen-qml.html
  12924. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-example.html
  12925. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-main-cpp.html
  12926. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-pro.html
  12927. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-multi-screen-qrc.html
  12928. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-chrome-qml.html
  12929. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-main-qml.html
  12930. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-multi-screen-qml-screen-qml.html
  12931. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-example.html
  12932. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-main-cpp.html
  12933. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-main-qml.html
  12934. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-overview-compositor-pro.html
  12935. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-overview-compositor-qrc.html
  12936. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-example.html
  12937. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-main-cpp.html
  12938. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-pro.html
  12939. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-pure-qml-qrc.html
  12940. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-chrome-qml.html
  12941. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-keyboard-qml.html
  12942. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-main-qml.html
  12943. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-pure-qml-qml-screen-qml.html
  12944. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-cpp.html
  12945. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-compositor-h.html
  12946. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-example.html
  12947. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-main-cpp.html
  12948. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-pro.html
  12949. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-qwindow-compositor-qrc.html
  12950. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-cpp.html
  12951. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-window-h.html
  12952. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-example.html
  12953. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-main-cpp.html
  12954. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-main-qml.html
  12955. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-server-side-decoration-pro.html
  12956. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-server-side-decoration-qrc.html
  12957. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-example.html
  12958. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-cpp.html
  12959. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-main-qml.html
  12960. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-pro.html
  12961. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-spanning-screens-qrc.html
  12962. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.index
  12963. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp
  12964. share/doc/qt5/qtwaylandcompositor/qtwaylandcompositor.qhp.sha1
  12965. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref-members.html
  12966. share/doc/qt5/qtwaylandcompositor/qwaylandbufferref.html
  12967. share/doc/qt5/qtwaylandcompositor/qwaylandclient-members.html
  12968. share/doc/qt5/qtwaylandcompositor/qwaylandclient-obsolete.html
  12969. share/doc/qt5/qtwaylandcompositor/qwaylandclient.html
  12970. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor-members.html
  12971. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor-obsolete.html
  12972. share/doc/qt5/qtwaylandcompositor/qwaylandcompositor.html
  12973. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication-members.html
  12974. share/doc/qt5/qtwaylandcompositor/qwaylandiviapplication.html
  12975. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface-members.html
  12976. share/doc/qt5/qtwaylandcompositor/qwaylandivisurface.html
  12977. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard-members.html
  12978. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard-obsolete.html
  12979. share/doc/qt5/qtwaylandcompositor/qwaylandkeyboard.html
  12980. share/doc/qt5/qtwaylandcompositor/qwaylandoutput-members.html
  12981. share/doc/qt5/qtwaylandcompositor/qwaylandoutput-obsolete.html
  12982. share/doc/qt5/qtwaylandcompositor/qwaylandoutput.html
  12983. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode-members.html
  12984. share/doc/qt5/qtwaylandcompositor/qwaylandoutputmode.html
  12985. share/doc/qt5/qtwaylandcompositor/qwaylandpointer-members.html
  12986. share/doc/qt5/qtwaylandcompositor/qwaylandpointer-obsolete.html
  12987. share/doc/qt5/qtwaylandcompositor/qwaylandpointer.html
  12988. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem-members.html
  12989. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem-obsolete.html
  12990. share/doc/qt5/qtwaylandcompositor/qwaylandquickitem.html
  12991. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem-members.html
  12992. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem-obsolete.html
  12993. share/doc/qt5/qtwaylandcompositor/qwaylandquickshellsurfaceitem.html
  12994. share/doc/qt5/qtwaylandcompositor/qwaylandseat-members.html
  12995. share/doc/qt5/qtwaylandcompositor/qwaylandseat-obsolete.html
  12996. share/doc/qt5/qtwaylandcompositor/qwaylandseat.html
  12997. share/doc/qt5/qtwaylandcompositor/qwaylandshellsurface-members.html
  12998. share/doc/qt5/qtwaylandcompositor/qwaylandshellsurface-obsolete.html
  12999. share/doc/qt5/qtwaylandcompositor/qwaylandshellsurface.html
  13000. share/doc/qt5/qtwaylandcompositor/qwaylandsurface-members.html
  13001. share/doc/qt5/qtwaylandcompositor/qwaylandsurface-obsolete.html
  13002. share/doc/qt5/qtwaylandcompositor/qwaylandsurface.html
  13003. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber-members.html
  13004. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber-obsolete.html
  13005. share/doc/qt5/qtwaylandcompositor/qwaylandsurfacegrabber.html
  13006. share/doc/qt5/qtwaylandcompositor/qwaylandtouch-members.html
  13007. share/doc/qt5/qtwaylandcompositor/qwaylandtouch-obsolete.html
  13008. share/doc/qt5/qtwaylandcompositor/qwaylandtouch.html
  13009. share/doc/qt5/qtwaylandcompositor/qwaylandview-members.html
  13010. share/doc/qt5/qtwaylandcompositor/qwaylandview-obsolete.html
  13011. share/doc/qt5/qtwaylandcompositor/qwaylandview.html
  13012. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell-members.html
  13013. share/doc/qt5/qtwaylandcompositor/qwaylandwlshell.html
  13014. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface-members.html
  13015. share/doc/qt5/qtwaylandcompositor/qwaylandwlshellsurface.html
  13016. share/doc/qt5/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1-members.html
  13017. share/doc/qt5/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1.html
  13018. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopup-members.html
  13019. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopup-obsolete.html
  13020. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopup.html
  13021. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5-members.html
  13022. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv5.html
  13023. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv6-members.html
  13024. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv6-obsolete.html
  13025. share/doc/qt5/qtwaylandcompositor/qwaylandxdgpopupv6.html
  13026. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshell-members.html
  13027. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshell.html
  13028. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5-members.html
  13029. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv5.html
  13030. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv6-members.html
  13031. share/doc/qt5/qtwaylandcompositor/qwaylandxdgshellv6.html
  13032. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurface-members.html
  13033. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurface.html
  13034. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5-members.html
  13035. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev5.html
  13036. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev6-members.html
  13037. share/doc/qt5/qtwaylandcompositor/qwaylandxdgsurfacev6.html
  13038. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevel-members.html
  13039. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevel-obsolete.html
  13040. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevel.html
  13041. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevelv6-members.html
  13042. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevelv6-obsolete.html
  13043. share/doc/qt5/qtwaylandcompositor/qwaylandxdgtoplevelv6.html
  13044. share/doc/qt5/qtwaylandcompositor/style/offline-simple.css
  13045. share/doc/qt5/qtwaylandcompositor/style/offline.css
  13046. share/doc/qt5/qtwebchannel.qch
  13047. share/doc/qt5/qtwebchannel/examples-manifest.xml
  13048. share/doc/qt5/qtwebchannel/images/arrow_bc.png
  13049. share/doc/qt5/qtwebchannel/images/bgrContent.png
  13050. share/doc/qt5/qtwebchannel/images/btn_next.png
  13051. share/doc/qt5/qtwebchannel/images/btn_prev.png
  13052. share/doc/qt5/qtwebchannel/images/bullet_dn.png
  13053. share/doc/qt5/qtwebchannel/images/bullet_sq.png
  13054. share/doc/qt5/qtwebchannel/images/chatclient-html.png
  13055. share/doc/qt5/qtwebchannel/images/chatclient-qml.png
  13056. share/doc/qt5/qtwebchannel/images/chatserver-cpp.png
  13057. share/doc/qt5/qtwebchannel/images/home.png
  13058. share/doc/qt5/qtwebchannel/images/ico_note.png
  13059. share/doc/qt5/qtwebchannel/images/ico_note_attention.png
  13060. share/doc/qt5/qtwebchannel/images/ico_out.png
  13061. share/doc/qt5/qtwebchannel/images/logo.png
  13062. share/doc/qt5/qtwebchannel/images/standalone-screenshot.png
  13063. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel-members.html
  13064. share/doc/qt5/qtwebchannel/qml-qtwebchannel-webchannel.html
  13065. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html-pro.html
  13066. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-chatclient-html.html
  13067. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-html-example.html
  13068. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-chatclient-qml-pro.html
  13069. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-example.html
  13070. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-loginform-ui-qml.html
  13071. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-mainform-ui-qml.html
  13072. share/doc/qt5/qtwebchannel/qtwebchannel-chatclient-qml-qmlchatclient-qml.html
  13073. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp-pro.html
  13074. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-cpp.html
  13075. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-chatserver-h.html
  13076. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
  13077. share/doc/qt5/qtwebchannel/qtwebchannel-chatserver-cpp-main-cpp.html
  13078. share/doc/qt5/qtwebchannel/qtwebchannel-examples.html
  13079. share/doc/qt5/qtwebchannel/qtwebchannel-index.html
  13080. share/doc/qt5/qtwebchannel/qtwebchannel-javascript.html
  13081. share/doc/qt5/qtwebchannel/qtwebchannel-module.html
  13082. share/doc/qt5/qtwebchannel/qtwebchannel-qmlmodule.html
  13083. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-core-h.html
  13084. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-cpp.html
  13085. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-h.html
  13086. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-dialog-ui.html
  13087. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-example.html
  13088. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-index-html.html
  13089. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-main-cpp.html
  13090. share/doc/qt5/qtwebchannel/qtwebchannel-standalone-standalone-pro.html
  13091. share/doc/qt5/qtwebchannel/qtwebchannel.index
  13092. share/doc/qt5/qtwebchannel/qtwebchannel.qhp
  13093. share/doc/qt5/qtwebchannel/qtwebchannel.qhp.sha1
  13094. share/doc/qt5/qtwebchannel/qtwebchannel.tags
  13095. share/doc/qt5/qtwebchannel/qwebchannel-members.html
  13096. share/doc/qt5/qtwebchannel/qwebchannel-obsolete.html
  13097. share/doc/qt5/qtwebchannel/qwebchannel.html
  13098. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport-members.html
  13099. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport-obsolete.html
  13100. share/doc/qt5/qtwebchannel/qwebchannelabstracttransport.html
  13101. share/doc/qt5/qtwebchannel/style/offline-simple.css
  13102. share/doc/qt5/qtwebchannel/style/offline.css
  13103. share/doc/qt5/qtwebsockets.qch
  13104. share/doc/qt5/qtwebsockets/echoclient.html
  13105. share/doc/qt5/qtwebsockets/echoserver.html
  13106. share/doc/qt5/qtwebsockets/examples-manifest.xml
  13107. share/doc/qt5/qtwebsockets/images/arrow_bc.png
  13108. share/doc/qt5/qtwebsockets/images/bgrContent.png
  13109. share/doc/qt5/qtwebsockets/images/btn_next.png
  13110. share/doc/qt5/qtwebsockets/images/btn_prev.png
  13111. share/doc/qt5/qtwebsockets/images/bullet_dn.png
  13112. share/doc/qt5/qtwebsockets/images/bullet_sq.png
  13113. share/doc/qt5/qtwebsockets/images/echoclient-html-example.png
  13114. share/doc/qt5/qtwebsockets/images/home.png
  13115. share/doc/qt5/qtwebsockets/images/ico_note.png
  13116. share/doc/qt5/qtwebsockets/images/ico_note_attention.png
  13117. share/doc/qt5/qtwebsockets/images/ico_out.png
  13118. share/doc/qt5/qtwebsockets/images/logo.png
  13119. share/doc/qt5/qtwebsockets/images/websockets-pictorial-representation.jpg
  13120. share/doc/qt5/qtwebsockets/qmaskgenerator-members.html
  13121. share/doc/qt5/qtwebsockets/qmaskgenerator-obsolete.html
  13122. share/doc/qt5/qtwebsockets/qmaskgenerator.html
  13123. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket-members.html
  13124. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocket.html
  13125. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
  13126. share/doc/qt5/qtwebsockets/qml-qtwebsockets-websocketserver.html
  13127. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-cpp.html
  13128. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-h.html
  13129. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-echoclient-pro.html
  13130. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-example.html
  13131. share/doc/qt5/qtwebsockets/qtwebsockets-echoclient-main-cpp.html
  13132. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoclient-html.html
  13133. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-cpp.html
  13134. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-h.html
  13135. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-echoserver-pro.html
  13136. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-example.html
  13137. share/doc/qt5/qtwebsockets/qtwebsockets-echoserver-main-cpp.html
  13138. share/doc/qt5/qtwebsockets/qtwebsockets-examples.html
  13139. share/doc/qt5/qtwebsockets/qtwebsockets-index.html
  13140. share/doc/qt5/qtwebsockets/qtwebsockets-module.html
  13141. share/doc/qt5/qtwebsockets/qtwebsockets-qmlmodule.html
  13142. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-data-qrc.html
  13143. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
  13144. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-main-cpp.html
  13145. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qml-qmlwebsocketclient-main-qml.html
  13146. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketclient-qmlwebsocketclient-pro.html
  13147. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-data-qrc.html
  13148. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
  13149. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-main-cpp.html
  13150. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qml-qmlwebsocketserver-main-qml.html
  13151. share/doc/qt5/qtwebsockets/qtwebsockets-qmlwebsocketserver-qmlwebsocketserver-pro.html
  13152. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatclient-html.html
  13153. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-cpp.html
  13154. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-chatserver-h.html
  13155. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-example.html
  13156. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-main-cpp.html
  13157. share/doc/qt5/qtwebsockets/qtwebsockets-simplechat-simplechat-pro.html
  13158. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-example.html
  13159. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-main-cpp.html
  13160. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-cpp.html
  13161. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-h.html
  13162. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoclient-sslechoclient-pro.html
  13163. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-example.html
  13164. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-main-cpp.html
  13165. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-securesocketclient-qrc.html
  13166. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoclient-html.html
  13167. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-cpp.html
  13168. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-h.html
  13169. share/doc/qt5/qtwebsockets/qtwebsockets-sslechoserver-sslechoserver-pro.html
  13170. share/doc/qt5/qtwebsockets/qtwebsockets-testing.html
  13171. share/doc/qt5/qtwebsockets/qtwebsockets.index
  13172. share/doc/qt5/qtwebsockets/qtwebsockets.qhp
  13173. share/doc/qt5/qtwebsockets/qtwebsockets.qhp.sha1
  13174. share/doc/qt5/qtwebsockets/qtwebsockets.tags
  13175. share/doc/qt5/qtwebsockets/qwebsocket-members.html
  13176. share/doc/qt5/qtwebsockets/qwebsocket-obsolete.html
  13177. share/doc/qt5/qtwebsockets/qwebsocket.html
  13178. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator-members.html
  13179. share/doc/qt5/qtwebsockets/qwebsocketcorsauthenticator.html
  13180. share/doc/qt5/qtwebsockets/qwebsocketprotocol.html
  13181. share/doc/qt5/qtwebsockets/qwebsocketserver-members.html
  13182. share/doc/qt5/qtwebsockets/qwebsocketserver-obsolete.html
  13183. share/doc/qt5/qtwebsockets/qwebsocketserver.html
  13184. share/doc/qt5/qtwebsockets/style/offline-simple.css
  13185. share/doc/qt5/qtwebsockets/style/offline.css
  13186. share/doc/qt5/qtwebsockets/websockets-overview.html
  13187. share/doc/qt5/qtwebview.qch
  13188. share/doc/qt5/qtwebview/examples-manifest.xml
  13189. share/doc/qt5/qtwebview/images/arrow_bc.png
  13190. share/doc/qt5/qtwebview/images/bgrContent.png
  13191. share/doc/qt5/qtwebview/images/btn_next.png
  13192. share/doc/qt5/qtwebview/images/btn_prev.png
  13193. share/doc/qt5/qtwebview/images/bullet_dn.png
  13194. share/doc/qt5/qtwebview/images/bullet_sq.png
  13195. share/doc/qt5/qtwebview/images/home.png
  13196. share/doc/qt5/qtwebview/images/ico_note.png
  13197. share/doc/qt5/qtwebview/images/ico_note_attention.png
  13198. share/doc/qt5/qtwebview/images/ico_out.png
  13199. share/doc/qt5/qtwebview/images/logo.png
  13200. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/left-32.png
  13201. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/refresh-32.png
  13202. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/right-32.png
  13203. share/doc/qt5/qtwebview/images/used-in-examples/minibrowser/images/stop-32.png
  13204. share/doc/qt5/qtwebview/images/webview-example.jpg
  13205. share/doc/qt5/qtwebview/qml-qtwebview-webview-members.html
  13206. share/doc/qt5/qtwebview/qml-qtwebview-webview.html
  13207. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest-members.html
  13208. share/doc/qt5/qtwebview/qml-qtwebview-webviewloadrequest.html
  13209. share/doc/qt5/qtwebview/qtwebview-examples.html
  13210. share/doc/qt5/qtwebview/qtwebview-index.html
  13211. share/doc/qt5/qtwebview/qtwebview-minibrowser-android-loadprogressstyle-qml.html
  13212. share/doc/qt5/qtwebview/qtwebview-minibrowser-example.html
  13213. share/doc/qt5/qtwebview/qtwebview-minibrowser-loadprogressstyle-qml.html
  13214. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-cpp.html
  13215. share/doc/qt5/qtwebview/qtwebview-minibrowser-main-qml.html
  13216. share/doc/qt5/qtwebview/qtwebview-minibrowser-minibrowser-pro.html
  13217. share/doc/qt5/qtwebview/qtwebview-minibrowser-qml-qrc.html
  13218. share/doc/qt5/qtwebview/qtwebview-module.html
  13219. share/doc/qt5/qtwebview/qtwebview-qmlmodule.html
  13220. share/doc/qt5/qtwebview/qtwebview.html
  13221. share/doc/qt5/qtwebview/qtwebview.index
  13222. share/doc/qt5/qtwebview/qtwebview.qhp
  13223. share/doc/qt5/qtwebview/qtwebview.qhp.sha1
  13224. share/doc/qt5/qtwebview/style/offline-simple.css
  13225. share/doc/qt5/qtwebview/style/offline.css
  13226. share/doc/qt5/qtwidgets.qch
  13227. share/doc/qt5/qtwidgets/application-windows.html
  13228. share/doc/qt5/qtwidgets/dialogs.html
  13229. share/doc/qt5/qtwidgets/examples-desktop.html
  13230. share/doc/qt5/qtwidgets/examples-dialogs.html
  13231. share/doc/qt5/qtwidgets/examples-graphicsview.html
  13232. share/doc/qt5/qtwidgets/examples-itemviews.html
  13233. share/doc/qt5/qtwidgets/examples-mainwindow.html
  13234. share/doc/qt5/qtwidgets/examples-manifest.xml
  13235. share/doc/qt5/qtwidgets/examples-painting.html
  13236. share/doc/qt5/qtwidgets/examples-richtext.html
  13237. share/doc/qt5/qtwidgets/examples-widgets.html
  13238. share/doc/qt5/qtwidgets/focus.html
  13239. share/doc/qt5/qtwidgets/gallery.html
  13240. share/doc/qt5/qtwidgets/gestures-overview.html
  13241. share/doc/qt5/qtwidgets/graphicsview.html
  13242. share/doc/qt5/qtwidgets/guibooks.html
  13243. share/doc/qt5/qtwidgets/images/addressbook-adddialog.png
  13244. share/doc/qt5/qtwidgets/images/addressbook-classes.png
  13245. share/doc/qt5/qtwidgets/images/addressbook-editdialog.png
  13246. share/doc/qt5/qtwidgets/images/addressbook-example.png
  13247. share/doc/qt5/qtwidgets/images/addressbook-filemenu.png
  13248. share/doc/qt5/qtwidgets/images/addressbook-newaddresstab.png
  13249. share/doc/qt5/qtwidgets/images/addressbook-signals.png
  13250. share/doc/qt5/qtwidgets/images/addressbook-toolsmenu.png
  13251. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-layout.png
  13252. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-labeled-screenshot.png
  13253. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part1-screenshot.png
  13254. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-contact.png
  13255. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-flowchart.png
  13256. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-add-successful.png
  13257. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-labeled-layout.png
  13258. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-signals-and-slots.png
  13259. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part2-stretch-effects.png
  13260. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-labeled-layout.png
  13261. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-linkedlist.png
  13262. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part3-screenshot.png
  13263. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part4-remove.png
  13264. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-finddialog.png
  13265. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-notfound.png
  13266. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-screenshot.png
  13267. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part5-signals-and-slots.png
  13268. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-load.png
  13269. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-save.png
  13270. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part6-screenshot.png
  13271. share/doc/qt5/qtwidgets/images/addressbook-tutorial-part7-screenshot.png
  13272. share/doc/qt5/qtwidgets/images/addressbook-tutorial-screenshot.png
  13273. share/doc/qt5/qtwidgets/images/affine-demo.png
  13274. share/doc/qt5/qtwidgets/images/analogclock-example.png
  13275. share/doc/qt5/qtwidgets/images/analogclock-viewport.png
  13276. share/doc/qt5/qtwidgets/images/animatedtiles-example.png
  13277. share/doc/qt5/qtwidgets/images/application-menus.png
  13278. share/doc/qt5/qtwidgets/images/application.png
  13279. share/doc/qt5/qtwidgets/images/arrow_bc.png
  13280. share/doc/qt5/qtwidgets/images/assistant-toolbar.png
  13281. share/doc/qt5/qtwidgets/images/basicdrawing-example.png
  13282. share/doc/qt5/qtwidgets/images/basicgraphicslayouts-example.png
  13283. share/doc/qt5/qtwidgets/images/basiclayouts-example.png
  13284. share/doc/qt5/qtwidgets/images/basicsortfiltermodel-example.png
  13285. share/doc/qt5/qtwidgets/images/bgrContent.png
  13286. share/doc/qt5/qtwidgets/images/blurpickereffect-example.png
  13287. share/doc/qt5/qtwidgets/images/borderlayout-example.png
  13288. share/doc/qt5/qtwidgets/images/boxes-demo.png
  13289. share/doc/qt5/qtwidgets/images/branchindicatorimage.png
  13290. share/doc/qt5/qtwidgets/images/btn_next.png
  13291. share/doc/qt5/qtwidgets/images/btn_prev.png
  13292. share/doc/qt5/qtwidgets/images/bullet_dn.png
  13293. share/doc/qt5/qtwidgets/images/bullet_sq.png
  13294. share/doc/qt5/qtwidgets/images/button.png
  13295. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
  13296. share/doc/qt5/qtwidgets/images/buttonbox-gnomelayout-vertical.png
  13297. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-horizontal.png
  13298. share/doc/qt5/qtwidgets/images/buttonbox-kdelayout-vertical.png
  13299. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
  13300. share/doc/qt5/qtwidgets/images/buttonbox-mac-modeless-vertical.png
  13301. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-horizontal.png
  13302. share/doc/qt5/qtwidgets/images/buttonbox-maclayout-vertical.png
  13303. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-horizontal.png
  13304. share/doc/qt5/qtwidgets/images/buttonbox-winlayout-vertical.png
  13305. share/doc/qt5/qtwidgets/images/calculator-example.png
  13306. share/doc/qt5/qtwidgets/images/calculator-ugly.png
  13307. share/doc/qt5/qtwidgets/images/calendar-example.png
  13308. share/doc/qt5/qtwidgets/images/calendarwidgetexample.png
  13309. share/doc/qt5/qtwidgets/images/charactermap-example.png
  13310. share/doc/qt5/qtwidgets/images/chart-example.png
  13311. share/doc/qt5/qtwidgets/images/checkbox.png
  13312. share/doc/qt5/qtwidgets/images/checkboxes-exclusive.png
  13313. share/doc/qt5/qtwidgets/images/checkboxes-non-exclusive.png
  13314. share/doc/qt5/qtwidgets/images/checkboxexample.png
  13315. share/doc/qt5/qtwidgets/images/chip-demo.png
  13316. share/doc/qt5/qtwidgets/images/classwizard-flow.png
  13317. share/doc/qt5/qtwidgets/images/classwizard.png
  13318. share/doc/qt5/qtwidgets/images/clock.png
  13319. share/doc/qt5/qtwidgets/images/codecs-example.png
  13320. share/doc/qt5/qtwidgets/images/codeeditor-example.png
  13321. share/doc/qt5/qtwidgets/images/collidingmice-example.png
  13322. share/doc/qt5/qtwidgets/images/coloreditorfactoryimage.png
  13323. share/doc/qt5/qtwidgets/images/columnview.png
  13324. share/doc/qt5/qtwidgets/images/combobox.png
  13325. share/doc/qt5/qtwidgets/images/comboboximage.png
  13326. share/doc/qt5/qtwidgets/images/combowidgetmapper-example.png
  13327. share/doc/qt5/qtwidgets/images/completer-example-country.png
  13328. share/doc/qt5/qtwidgets/images/completer-example-dirmodel.png
  13329. share/doc/qt5/qtwidgets/images/completer-example-qdirmodel.png
  13330. share/doc/qt5/qtwidgets/images/completer-example-word.png
  13331. share/doc/qt5/qtwidgets/images/completer-example.png
  13332. share/doc/qt5/qtwidgets/images/composition-demo.png
  13333. share/doc/qt5/qtwidgets/images/concentriccircles-example.png
  13334. share/doc/qt5/qtwidgets/images/conceptualpushbuttontree.png
  13335. share/doc/qt5/qtwidgets/images/customcompleter-example.png
  13336. share/doc/qt5/qtwidgets/images/customcompleter-insertcompletion.png
  13337. share/doc/qt5/qtwidgets/images/customsortfiltermodel-example.png
  13338. share/doc/qt5/qtwidgets/images/deform-demo.png
  13339. share/doc/qt5/qtwidgets/images/designer-stylesheet-options.png
  13340. share/doc/qt5/qtwidgets/images/designer-stylesheet-usage.png
  13341. share/doc/qt5/qtwidgets/images/designer-validator-highlighter.png
  13342. share/doc/qt5/qtwidgets/images/desktop-examples.png
  13343. share/doc/qt5/qtwidgets/images/diagramscene.png
  13344. share/doc/qt5/qtwidgets/images/dialog-examples.png
  13345. share/doc/qt5/qtwidgets/images/digitalclock-example.png
  13346. share/doc/qt5/qtwidgets/images/dirview-example.png
  13347. share/doc/qt5/qtwidgets/images/dockwidget.png
  13348. share/doc/qt5/qtwidgets/images/dockwidgetimage.png
  13349. share/doc/qt5/qtwidgets/images/dockwidgets-example.png
  13350. share/doc/qt5/qtwidgets/images/draganddroppuzzle-example.png
  13351. share/doc/qt5/qtwidgets/images/dragdroprobot-example.png
  13352. share/doc/qt5/qtwidgets/images/draggableicons-example.png
  13353. share/doc/qt5/qtwidgets/images/draggabletext-example.png
  13354. share/doc/qt5/qtwidgets/images/dropsite-example.png
  13355. share/doc/qt5/qtwidgets/images/dummy_tree.png
  13356. share/doc/qt5/qtwidgets/images/dynamiclayouts-example.png
  13357. share/doc/qt5/qtwidgets/images/easing-example.png
  13358. share/doc/qt5/qtwidgets/images/echopluginexample.png
  13359. share/doc/qt5/qtwidgets/images/elasticnodes-example.png
  13360. share/doc/qt5/qtwidgets/images/elidedlabel-example.png
  13361. share/doc/qt5/qtwidgets/images/embeddeddialogs-demo.png
  13362. share/doc/qt5/qtwidgets/images/example_model.png
  13363. share/doc/qt5/qtwidgets/images/extension-example.png
  13364. share/doc/qt5/qtwidgets/images/extension_more.png
  13365. share/doc/qt5/qtwidgets/images/factorial-example.png
  13366. share/doc/qt5/qtwidgets/images/fademessageeffect-example-faded.png
  13367. share/doc/qt5/qtwidgets/images/fademessageeffect-example.png
  13368. share/doc/qt5/qtwidgets/images/fetchmore-example.png
  13369. share/doc/qt5/qtwidgets/images/filedialogurls.png
  13370. share/doc/qt5/qtwidgets/images/findfiles-example.png
  13371. share/doc/qt5/qtwidgets/images/findfiles_progress_dialog.png
  13372. share/doc/qt5/qtwidgets/images/flowlayout-example.png
  13373. share/doc/qt5/qtwidgets/images/fontsampler-example.png
  13374. share/doc/qt5/qtwidgets/images/frames.png
  13375. share/doc/qt5/qtwidgets/images/fridgemagnets-example.png
  13376. share/doc/qt5/qtwidgets/images/frozencolumn-example.png
  13377. share/doc/qt5/qtwidgets/images/frozencolumn-tableview.png
  13378. share/doc/qt5/qtwidgets/images/fusion-calendarwidget.png
  13379. share/doc/qt5/qtwidgets/images/fusion-colordialog.png
  13380. share/doc/qt5/qtwidgets/images/fusion-combobox.png
  13381. share/doc/qt5/qtwidgets/images/fusion-fontdialog.png
  13382. share/doc/qt5/qtwidgets/images/fusion-label.png
  13383. share/doc/qt5/qtwidgets/images/fusion-menu.png
  13384. share/doc/qt5/qtwidgets/images/fusion-progressdialog.png
  13385. share/doc/qt5/qtwidgets/images/fusion-pushbutton-menu.png
  13386. share/doc/qt5/qtwidgets/images/fusion-statusbar-sizegrip.png
  13387. share/doc/qt5/qtwidgets/images/fusion-style.png
  13388. share/doc/qt5/qtwidgets/images/fusion-tabbar-truncated.png
  13389. share/doc/qt5/qtwidgets/images/fusion-tabbar.png
  13390. share/doc/qt5/qtwidgets/images/fusion-tabwidget.png
  13391. share/doc/qt5/qtwidgets/images/geometry.png
  13392. share/doc/qt5/qtwidgets/images/gradients-demo.png
  13393. share/doc/qt5/qtwidgets/images/graphicsanchorlayout-example.png
  13394. share/doc/qt5/qtwidgets/images/graphicseffect-blur.png
  13395. share/doc/qt5/qtwidgets/images/graphicseffect-colorize.png
  13396. share/doc/qt5/qtwidgets/images/graphicseffect-drop-shadow.png
  13397. share/doc/qt5/qtwidgets/images/graphicseffect-opacity.png
  13398. share/doc/qt5/qtwidgets/images/graphicseffect-plain.png
  13399. share/doc/qt5/qtwidgets/images/graphicseffect-widget.png
  13400. share/doc/qt5/qtwidgets/images/graphicsflowlayout-example.png
  13401. share/doc/qt5/qtwidgets/images/graphicssimpleanchorlayout-example.png
  13402. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem-pie.png
  13403. share/doc/qt5/qtwidgets/images/graphicsview-ellipseitem.png
  13404. share/doc/qt5/qtwidgets/images/graphicsview-examples.png
  13405. share/doc/qt5/qtwidgets/images/graphicsview-items.png
  13406. share/doc/qt5/qtwidgets/images/graphicsview-lineitem.png
  13407. share/doc/qt5/qtwidgets/images/graphicsview-parentchild.png
  13408. share/doc/qt5/qtwidgets/images/graphicsview-pathitem.png
  13409. share/doc/qt5/qtwidgets/images/graphicsview-pixmapitem.png
  13410. share/doc/qt5/qtwidgets/images/graphicsview-polygonitem.png
  13411. share/doc/qt5/qtwidgets/images/graphicsview-rectitem.png
  13412. share/doc/qt5/qtwidgets/images/graphicsview-simpletextitem.png
  13413. share/doc/qt5/qtwidgets/images/graphicsview-textitem.png
  13414. share/doc/qt5/qtwidgets/images/graphicsview-view.png
  13415. share/doc/qt5/qtwidgets/images/graphicsview-zorder.png
  13416. share/doc/qt5/qtwidgets/images/groupbox-example.png
  13417. share/doc/qt5/qtwidgets/images/groupbox.png
  13418. share/doc/qt5/qtwidgets/images/groupboximage.png
  13419. share/doc/qt5/qtwidgets/images/header.png
  13420. share/doc/qt5/qtwidgets/images/headerimage.png
  13421. share/doc/qt5/qtwidgets/images/home.png
  13422. share/doc/qt5/qtwidgets/images/i18n-example.png
  13423. share/doc/qt5/qtwidgets/images/ico_note.png
  13424. share/doc/qt5/qtwidgets/images/ico_note_attention.png
  13425. share/doc/qt5/qtwidgets/images/ico_out.png
  13426. share/doc/qt5/qtwidgets/images/icons-example.png
  13427. share/doc/qt5/qtwidgets/images/icons-view-menu.png
  13428. share/doc/qt5/qtwidgets/images/icons_find_normal.png
  13429. share/doc/qt5/qtwidgets/images/icons_find_normal_disabled.png
  13430. share/doc/qt5/qtwidgets/images/icons_images_groupbox.png
  13431. share/doc/qt5/qtwidgets/images/icons_monkey.png
  13432. share/doc/qt5/qtwidgets/images/icons_monkey_active.png
  13433. share/doc/qt5/qtwidgets/images/icons_monkey_mess.png
  13434. share/doc/qt5/qtwidgets/images/icons_preview_area.png
  13435. share/doc/qt5/qtwidgets/images/icons_qt_extended_16x16.png
  13436. share/doc/qt5/qtwidgets/images/icons_qt_extended_17x17.png
  13437. share/doc/qt5/qtwidgets/images/icons_qt_extended_32x32.png
  13438. share/doc/qt5/qtwidgets/images/icons_qt_extended_33x33.png
  13439. share/doc/qt5/qtwidgets/images/icons_qt_extended_48x48.png
  13440. share/doc/qt5/qtwidgets/images/icons_qt_extended_64x64.png
  13441. share/doc/qt5/qtwidgets/images/icons_qt_extended_8x8.png
  13442. share/doc/qt5/qtwidgets/images/icons_size_groupbox.png
  13443. share/doc/qt5/qtwidgets/images/icons_size_spinbox.png
  13444. share/doc/qt5/qtwidgets/images/imagecomposition-example.png
  13445. share/doc/qt5/qtwidgets/images/imagegestures-example.jpg
  13446. share/doc/qt5/qtwidgets/images/imageviewer-example.png
  13447. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_1.png
  13448. share/doc/qt5/qtwidgets/images/imageviewer-fit_to_window_2.png
  13449. share/doc/qt5/qtwidgets/images/imageviewer-original_size.png
  13450. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_1.png
  13451. share/doc/qt5/qtwidgets/images/imageviewer-zoom_in_2.png
  13452. share/doc/qt5/qtwidgets/images/inputdialogs.png
  13453. share/doc/qt5/qtwidgets/images/interview-demo.png
  13454. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-indexes.png
  13455. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-items.png
  13456. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-model.png
  13457. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel-values.png
  13458. share/doc/qt5/qtwidgets/images/itemviews-editabletreemodel.png
  13459. share/doc/qt5/qtwidgets/images/itemviews-examples.png
  13460. share/doc/qt5/qtwidgets/images/itemviewspuzzle-example.png
  13461. share/doc/qt5/qtwidgets/images/layout1.png
  13462. share/doc/qt5/qtwidgets/images/layout2.png
  13463. share/doc/qt5/qtwidgets/images/licensewizard-example.png
  13464. share/doc/qt5/qtwidgets/images/licensewizard-flow.png
  13465. share/doc/qt5/qtwidgets/images/lineedits-example.png
  13466. share/doc/qt5/qtwidgets/images/list_table_tree.png
  13467. share/doc/qt5/qtwidgets/images/listview.png
  13468. share/doc/qt5/qtwidgets/images/logo.png
  13469. share/doc/qt5/qtwidgets/images/macos-lineedit.png
  13470. share/doc/qt5/qtwidgets/images/macos-progressbar.png
  13471. share/doc/qt5/qtwidgets/images/macos-style.png
  13472. share/doc/qt5/qtwidgets/images/macos-style2.png
  13473. share/doc/qt5/qtwidgets/images/macos-tabwidget.png
  13474. share/doc/qt5/qtwidgets/images/mainwindow-demo.png
  13475. share/doc/qt5/qtwidgets/images/mainwindow-docks-example.png
  13476. share/doc/qt5/qtwidgets/images/mainwindow-docks.png
  13477. share/doc/qt5/qtwidgets/images/mainwindow-examples.png
  13478. share/doc/qt5/qtwidgets/images/mainwindowlayout.png
  13479. share/doc/qt5/qtwidgets/images/mdi-cascade.png
  13480. share/doc/qt5/qtwidgets/images/mdi-example.png
  13481. share/doc/qt5/qtwidgets/images/mdi-tile.png
  13482. share/doc/qt5/qtwidgets/images/menu.png
  13483. share/doc/qt5/qtwidgets/images/menubar.png
  13484. share/doc/qt5/qtwidgets/images/menubarimage.png
  13485. share/doc/qt5/qtwidgets/images/menuimage.png
  13486. share/doc/qt5/qtwidgets/images/menus-example.png
  13487. share/doc/qt5/qtwidgets/images/modelview-combobox.png
  13488. share/doc/qt5/qtwidgets/images/modelview-header.png
  13489. share/doc/qt5/qtwidgets/images/modelview-models.png
  13490. share/doc/qt5/qtwidgets/images/modelview-overview.png
  13491. share/doc/qt5/qtwidgets/images/modelview-roles.png
  13492. share/doc/qt5/qtwidgets/images/modelview-tablemodel.png
  13493. share/doc/qt5/qtwidgets/images/modelview-treemodel.png
  13494. share/doc/qt5/qtwidgets/images/modelview.png
  13495. share/doc/qt5/qtwidgets/images/mousebutton-buttontester.png
  13496. share/doc/qt5/qtwidgets/images/move-blocks-chart.png
  13497. share/doc/qt5/qtwidgets/images/moveblocks-example.png
  13498. share/doc/qt5/qtwidgets/images/movie-example.png
  13499. share/doc/qt5/qtwidgets/images/msgbox1.png
  13500. share/doc/qt5/qtwidgets/images/msgbox2.png
  13501. share/doc/qt5/qtwidgets/images/msgbox3.png
  13502. share/doc/qt5/qtwidgets/images/msgbox4.png
  13503. share/doc/qt5/qtwidgets/images/notepad1.png
  13504. share/doc/qt5/qtwidgets/images/notepad2.png
  13505. share/doc/qt5/qtwidgets/images/notepad3.png
  13506. share/doc/qt5/qtwidgets/images/notepad4.png
  13507. share/doc/qt5/qtwidgets/images/orderform-example-detailsdialog.png
  13508. share/doc/qt5/qtwidgets/images/orderform-example.png
  13509. share/doc/qt5/qtwidgets/images/padnavigator-example.png
  13510. share/doc/qt5/qtwidgets/images/painterpaths-example.png
  13511. share/doc/qt5/qtwidgets/images/painting-examples.png
  13512. share/doc/qt5/qtwidgets/images/paintsystem-icon.png
  13513. share/doc/qt5/qtwidgets/images/paintsystem-stylepainter.png
  13514. share/doc/qt5/qtwidgets/images/pangesture.png
  13515. share/doc/qt5/qtwidgets/images/parent-child-widgets.png
  13516. share/doc/qt5/qtwidgets/images/pathstroke-demo.png
  13517. share/doc/qt5/qtwidgets/images/pinchgesture.png
  13518. share/doc/qt5/qtwidgets/images/pingpong-example.png
  13519. share/doc/qt5/qtwidgets/images/pixelator-example.png
  13520. share/doc/qt5/qtwidgets/images/plugandpaint-plugindialog.png
  13521. share/doc/qt5/qtwidgets/images/plugandpaint.png
  13522. share/doc/qt5/qtwidgets/images/progressBar-stylesheet.png
  13523. share/doc/qt5/qtwidgets/images/progressBar2-stylesheet.png
  13524. share/doc/qt5/qtwidgets/images/progressbar.png
  13525. share/doc/qt5/qtwidgets/images/progressbarimage.png
  13526. share/doc/qt5/qtwidgets/images/propagation-custom.png
  13527. share/doc/qt5/qtwidgets/images/propagation-standard.png
  13528. share/doc/qt5/qtwidgets/images/pushbutton.png
  13529. share/doc/qt5/qtwidgets/images/qactiongroup-align.png
  13530. share/doc/qt5/qtwidgets/images/qcalendarwidget-grid.png
  13531. share/doc/qt5/qtwidgets/images/qcalendarwidget-maximum.png
  13532. share/doc/qt5/qtwidgets/images/qcalendarwidget-minimum.png
  13533. share/doc/qt5/qtwidgets/images/qcolumnview.png
  13534. share/doc/qt5/qtwidgets/images/qcompleter.png
  13535. share/doc/qt5/qtwidgets/images/qdesktopwidget.png
  13536. share/doc/qt5/qtwidgets/images/qerrormessage.png
  13537. share/doc/qt5/qtwidgets/images/qformlayout-kde.png
  13538. share/doc/qt5/qtwidgets/images/qformlayout-mac.png
  13539. share/doc/qt5/qtwidgets/images/qformlayout-qpe.png
  13540. share/doc/qt5/qtwidgets/images/qformlayout-win.png
  13541. share/doc/qt5/qtwidgets/images/qformlayout-with-6-children.png
  13542. share/doc/qt5/qtwidgets/images/qgraphicsproxywidget-embed.png
  13543. share/doc/qt5/qtwidgets/images/qgridlayout-with-5-children.png
  13544. share/doc/qt5/qtwidgets/images/qgridlayout.png
  13545. share/doc/qt5/qtwidgets/images/qhboxlayout-with-5-children.png
  13546. share/doc/qt5/qtwidgets/images/qmdisubwindowlayout.png
  13547. share/doc/qt5/qtwidgets/images/qmessagebox-crit.png
  13548. share/doc/qt5/qtwidgets/images/qmessagebox-info.png
  13549. share/doc/qt5/qtwidgets/images/qmessagebox-quest.png
  13550. share/doc/qt5/qtwidgets/images/qmessagebox-warn.png
  13551. share/doc/qt5/qtwidgets/images/qscrollarea-noscrollbars.png
  13552. share/doc/qt5/qtwidgets/images/qscrollarea-onescrollbar.png
  13553. share/doc/qt5/qtwidgets/images/qscrollarea-twoscrollbars.png
  13554. share/doc/qt5/qtwidgets/images/qscrollbar-picture.png
  13555. share/doc/qt5/qtwidgets/images/qscrollbar-values.png
  13556. share/doc/qt5/qtwidgets/images/qspinbox-plusminus.png
  13557. share/doc/qt5/qtwidgets/images/qspinbox-updown.png
  13558. share/doc/qt5/qtwidgets/images/qstyle-comboboxes.png
  13559. share/doc/qt5/qtwidgets/images/qstyleoptiontoolbar-position.png
  13560. share/doc/qt5/qtwidgets/images/qtableview-resized.png
  13561. share/doc/qt5/qtwidgets/images/qtwizard-aero1.png
  13562. share/doc/qt5/qtwidgets/images/qtwizard-aero2.png
  13563. share/doc/qt5/qtwidgets/images/qtwizard-classic1.png
  13564. share/doc/qt5/qtwidgets/images/qtwizard-classic2.png
  13565. share/doc/qt5/qtwidgets/images/qtwizard-mac1.png
  13566. share/doc/qt5/qtwidgets/images/qtwizard-mac2.png
  13567. share/doc/qt5/qtwidgets/images/qtwizard-macpage.png
  13568. share/doc/qt5/qtwidgets/images/qtwizard-modern1.png
  13569. share/doc/qt5/qtwidgets/images/qtwizard-modern2.png
  13570. share/doc/qt5/qtwidgets/images/qtwizard-nonmacpage.png
  13571. share/doc/qt5/qtwidgets/images/qundoview.png
  13572. share/doc/qt5/qtwidgets/images/qvboxlayout-with-5-children.png
  13573. share/doc/qt5/qtwidgets/images/readonlytable_role.png
  13574. share/doc/qt5/qtwidgets/images/regexp-example.png
  13575. share/doc/qt5/qtwidgets/images/regularexpression-example.png
  13576. share/doc/qt5/qtwidgets/images/richtext-examples.png
  13577. share/doc/qt5/qtwidgets/images/rogue-example.png
  13578. share/doc/qt5/qtwidgets/images/rogue-statechart.png
  13579. share/doc/qt5/qtwidgets/images/rubberband.png
  13580. share/doc/qt5/qtwidgets/images/rubberbandimage.png
  13581. share/doc/qt5/qtwidgets/images/screenshot-example.png
  13582. share/doc/qt5/qtwidgets/images/scribble-example.png
  13583. share/doc/qt5/qtwidgets/images/scrollbar.png
  13584. share/doc/qt5/qtwidgets/images/scrollbarimage.png
  13585. share/doc/qt5/qtwidgets/images/sdi-example.png
  13586. share/doc/qt5/qtwidgets/images/selected-items1.png
  13587. share/doc/qt5/qtwidgets/images/selected-items2.png
  13588. share/doc/qt5/qtwidgets/images/selected-items3.png
  13589. share/doc/qt5/qtwidgets/images/selection-extended.png
  13590. share/doc/qt5/qtwidgets/images/selection-multi.png
  13591. share/doc/qt5/qtwidgets/images/selection-single.png
  13592. share/doc/qt5/qtwidgets/images/selection2.png
  13593. share/doc/qt5/qtwidgets/images/settingseditor-example.png
  13594. share/doc/qt5/qtwidgets/images/shapedclock-dragging.png
  13595. share/doc/qt5/qtwidgets/images/shapedclock-example.png
  13596. share/doc/qt5/qtwidgets/images/shareddirmodel.png
  13597. share/doc/qt5/qtwidgets/images/sharedmodel-tableviews.png
  13598. share/doc/qt5/qtwidgets/images/sharedselection-tableviews.png
  13599. share/doc/qt5/qtwidgets/images/signals-n-slots-aw-nat.png
  13600. share/doc/qt5/qtwidgets/images/simpleanchorlayout-example.png
  13601. share/doc/qt5/qtwidgets/images/simpledommodel-example.png
  13602. share/doc/qt5/qtwidgets/images/simpletreemodel-example.png
  13603. share/doc/qt5/qtwidgets/images/simplewidgetmapper-example.png
  13604. share/doc/qt5/qtwidgets/images/sizegrip.png
  13605. share/doc/qt5/qtwidgets/images/sizegripimage.png
  13606. share/doc/qt5/qtwidgets/images/slider.png
  13607. share/doc/qt5/qtwidgets/images/sliderimage.png
  13608. share/doc/qt5/qtwidgets/images/sliders-example.png
  13609. share/doc/qt5/qtwidgets/images/spinbox.png
  13610. share/doc/qt5/qtwidgets/images/spinboxdelegate-example.png
  13611. share/doc/qt5/qtwidgets/images/spinboxes-example.png
  13612. share/doc/qt5/qtwidgets/images/spinboximage.png
  13613. share/doc/qt5/qtwidgets/images/spreadsheet-demo.png
  13614. share/doc/qt5/qtwidgets/images/standard-views.png
  13615. share/doc/qt5/qtwidgets/images/standarddialogs-example.png
  13616. share/doc/qt5/qtwidgets/images/standardwidget.png
  13617. share/doc/qt5/qtwidgets/images/stardelegate.png
  13618. share/doc/qt5/qtwidgets/images/states-example.png
  13619. share/doc/qt5/qtwidgets/images/stickman-example.png
  13620. share/doc/qt5/qtwidgets/images/stickman-example1.png
  13621. share/doc/qt5/qtwidgets/images/stickman-example2.png
  13622. share/doc/qt5/qtwidgets/images/stickman-example3.png
  13623. share/doc/qt5/qtwidgets/images/stringlistmodel.png
  13624. share/doc/qt5/qtwidgets/images/stylepluginexample.png
  13625. share/doc/qt5/qtwidgets/images/styles-3d.png
  13626. share/doc/qt5/qtwidgets/images/styles-aliasing.png
  13627. share/doc/qt5/qtwidgets/images/styles-disabledwood.png
  13628. share/doc/qt5/qtwidgets/images/styles-enabledwood.png
  13629. share/doc/qt5/qtwidgets/images/styles-woodbuttons.png
  13630. share/doc/qt5/qtwidgets/images/stylesheet-border-image-normal.png
  13631. share/doc/qt5/qtwidgets/images/stylesheet-border-image-stretched.png
  13632. share/doc/qt5/qtwidgets/images/stylesheet-border-image-wrong.png
  13633. share/doc/qt5/qtwidgets/images/stylesheet-boxmodel.png
  13634. share/doc/qt5/qtwidgets/images/stylesheet-branch-closed.png
  13635. share/doc/qt5/qtwidgets/images/stylesheet-branch-end.png
  13636. share/doc/qt5/qtwidgets/images/stylesheet-branch-more.png
  13637. share/doc/qt5/qtwidgets/images/stylesheet-branch-open.png
  13638. share/doc/qt5/qtwidgets/images/stylesheet-coffee-cleanlooks.png
  13639. share/doc/qt5/qtwidgets/images/stylesheet-pagefold-mac.png
  13640. share/doc/qt5/qtwidgets/images/stylesheet-pagefold.png
  13641. share/doc/qt5/qtwidgets/images/stylesheet-redbutton1.png
  13642. share/doc/qt5/qtwidgets/images/stylesheet-redbutton2.png
  13643. share/doc/qt5/qtwidgets/images/stylesheet-redbutton3.png
  13644. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar1.png
  13645. share/doc/qt5/qtwidgets/images/stylesheet-scrollbar2.png
  13646. share/doc/qt5/qtwidgets/images/stylesheet-treeview.png
  13647. share/doc/qt5/qtwidgets/images/stylesheet-vline.png
  13648. share/doc/qt5/qtwidgets/images/sub-attaq-demo.png
  13649. share/doc/qt5/qtwidgets/images/swipegesture.png
  13650. share/doc/qt5/qtwidgets/images/syntaxhighlighter-example.png
  13651. share/doc/qt5/qtwidgets/images/system-tray.png
  13652. share/doc/qt5/qtwidgets/images/systemtray-editor.png
  13653. share/doc/qt5/qtwidgets/images/systemtray-example.png
  13654. share/doc/qt5/qtwidgets/images/tab.png
  13655. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet1.png
  13656. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet2.png
  13657. share/doc/qt5/qtwidgets/images/tabWidget-stylesheet3.png
  13658. share/doc/qt5/qtwidgets/images/tabdialog-example.png
  13659. share/doc/qt5/qtwidgets/images/tableWidget-stylesheet.png
  13660. share/doc/qt5/qtwidgets/images/tabletexample.png
  13661. share/doc/qt5/qtwidgets/images/tableview.png
  13662. share/doc/qt5/qtwidgets/images/tabwidget.png
  13663. share/doc/qt5/qtwidgets/images/tetrix-example.png
  13664. share/doc/qt5/qtwidgets/images/textedit-demo.png
  13665. share/doc/qt5/qtwidgets/images/titlebar.png
  13666. share/doc/qt5/qtwidgets/images/titlebarimage.png
  13667. share/doc/qt5/qtwidgets/images/toolbar.png
  13668. share/doc/qt5/qtwidgets/images/toolbarimage.png
  13669. share/doc/qt5/qtwidgets/images/toolbox.png
  13670. share/doc/qt5/qtwidgets/images/toolboximage.png
  13671. share/doc/qt5/qtwidgets/images/toolbutton.png
  13672. share/doc/qt5/qtwidgets/images/toolbuttonimage.png
  13673. share/doc/qt5/qtwidgets/images/tooltips-example.png
  13674. share/doc/qt5/qtwidgets/images/touch-dials-example.png
  13675. share/doc/qt5/qtwidgets/images/touch-fingerpaint-example.png
  13676. share/doc/qt5/qtwidgets/images/touch-knobs-example.png
  13677. share/doc/qt5/qtwidgets/images/touch-pinchzoom-example.png
  13678. share/doc/qt5/qtwidgets/images/trafficlight-example.png
  13679. share/doc/qt5/qtwidgets/images/trafficlight-example1.png
  13680. share/doc/qt5/qtwidgets/images/trafficlight-example2.png
  13681. share/doc/qt5/qtwidgets/images/transformations-example.png
  13682. share/doc/qt5/qtwidgets/images/transitions.png
  13683. share/doc/qt5/qtwidgets/images/tree_2_with_algorithm.png
  13684. share/doc/qt5/qtwidgets/images/treemodel-structure.png
  13685. share/doc/qt5/qtwidgets/images/treemodelcompleter-example.png
  13686. share/doc/qt5/qtwidgets/images/treeview.png
  13687. share/doc/qt5/qtwidgets/images/trivialwizard-example-conclusion.png
  13688. share/doc/qt5/qtwidgets/images/trivialwizard-example-flow.png
  13689. share/doc/qt5/qtwidgets/images/trivialwizard-example-introduction.png
  13690. share/doc/qt5/qtwidgets/images/trivialwizard-example-registration.png
  13691. share/doc/qt5/qtwidgets/images/undodemo.png
  13692. share/doc/qt5/qtwidgets/images/undoframeworkexample.png
  13693. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/Time-For-Lunch-2.jpg
  13694. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/centered.png
  13695. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/ellipse.png
  13696. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/figure8.png
  13697. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/kinetic.png
  13698. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/random.png
  13699. share/doc/qt5/qtwidgets/images/used-in-examples/animation/animatedtiles/images/tile.png
  13700. share/doc/qt5/qtwidgets/images/used-in-examples/animation/easing/images/qt-logo.png
  13701. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/accessories-dictionary.png
  13702. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/akregator.png
  13703. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/digikam.png
  13704. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/help-browser.png
  13705. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/k3b.png
  13706. share/doc/qt5/qtwidgets/images/used-in-examples/animation/states/kchart.png
  13707. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/background.png
  13708. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/boat.png
  13709. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/bomb.png
  13710. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step1.png
  13711. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step2.png
  13712. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step3.png
  13713. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/boat/step4.png
  13714. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step1.png
  13715. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step2.png
  13716. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step3.png
  13717. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/explosion/submarine/step4.png
  13718. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/submarine.png
  13719. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/surface.png
  13720. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/big/torpedo.png
  13721. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/background.png
  13722. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/boat.png
  13723. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/bomb.png
  13724. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/submarine.png
  13725. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/surface.png
  13726. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/small/torpedo.png
  13727. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-a.png
  13728. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-a2.png
  13729. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-b.png
  13730. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-dash.png
  13731. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-excl.png
  13732. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-q.png
  13733. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-s.png
  13734. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-t.png
  13735. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-t2.png
  13736. share/doc/qt5/qtwidgets/images/used-in-examples/animation/sub-attaq/pics/welcome/logo-u.png
  13737. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/bad.png
  13738. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/heart.png
  13739. share/doc/qt5/qtwidgets/images/used-in-examples/desktop/systray/images/trash.png
  13740. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/background.png
  13741. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/banner.png
  13742. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo1.png
  13743. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo2.png
  13744. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/logo3.png
  13745. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark1.png
  13746. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/classwizard/images/watermark2.png
  13747. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/logo.png
  13748. share/doc/qt5/qtwidgets/images/used-in-examples/dialogs/licensewizard/images/watermark.png
  13749. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/boat.png
  13750. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/car.png
  13751. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/draggableicons/images/house.png
  13752. share/doc/qt5/qtwidgets/images/used-in-examples/draganddrop/puzzle/example.jpg
  13753. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-calculator.png
  13754. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/accessories-text-editor.png
  13755. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/background.jpg
  13756. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/help-browser.png
  13757. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-group-chat.png
  13758. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-mail.png
  13759. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/internet-web-browser.png
  13760. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/office-calendar.png
  13761. share/doc/qt5/qtwidgets/images/used-in-examples/effects/blurpicker/images/system-users.png
  13762. share/doc/qt5/qtwidgets/images/used-in-examples/effects/fademessage/background.jpg
  13763. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/basicgraphicslayouts/images/block.png
  13764. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negx.jpg
  13765. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negy.jpg
  13766. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_negz.jpg
  13767. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posx.jpg
  13768. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posy.jpg
  13769. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/cubemap_posz.jpg
  13770. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/qt-logo.jpg
  13771. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/qt-logo.png
  13772. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/smiley.png
  13773. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/boxes/square.jpg
  13774. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/fileprint.png
  13775. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/qt4logo.png
  13776. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/rotateleft.png
  13777. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/rotateright.png
  13778. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/zoomin.png
  13779. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/chip/zoomout.png
  13780. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/collidingmice/images/cheese.jpg
  13781. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background1.png
  13782. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background2.png
  13783. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background3.png
  13784. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/background4.png
  13785. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bold.png
  13786. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/bringtofront.png
  13787. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/delete.png
  13788. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/floodfill.png
  13789. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/italic.png
  13790. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linecolor.png
  13791. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/linepointer.png
  13792. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/pointer.png
  13793. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/sendtoback.png
  13794. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/textpointer.png
  13795. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/diagramscene/images/underline.png
  13796. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/dragdroprobot/images/head.png
  13797. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/embeddeddialogs/No-Ones-Laughing-3.jpg
  13798. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/artsfftscope.png
  13799. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/blue_angle_swirl.jpg
  13800. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_contacts.png
  13801. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_journal.png
  13802. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_mail.png
  13803. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kontact_notes.png
  13804. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/kopeteavailable.png
  13805. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/metacontact_online.png
  13806. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/padnavigator/images/minitools.png
  13807. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/5days.jpg
  13808. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/details.jpg
  13809. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/place.jpg
  13810. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/tabbar.jpg
  13811. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/title.jpg
  13812. share/doc/qt5/qtwidgets/images/used-in-examples/graphicsview/weatheranchorlayout/images/weather-few-clouds.png
  13813. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/customsortfiltermodel/images/find.png
  13814. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/folder.png
  13815. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/interview.png
  13816. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/interview/images/services.png
  13817. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/pixelator/images/qt.png
  13818. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/puzzle/example.jpg
  13819. share/doc/qt5/qtwidgets/images/used-in-examples/itemviews/spreadsheet/images/interview.png
  13820. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/copy.png
  13821. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/cut.png
  13822. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/new.png
  13823. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/open.png
  13824. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/paste.png
  13825. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/application/images/save.png
  13826. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/new.png
  13827. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/print.png
  13828. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/save.png
  13829. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/dockwidgets/images/undo.png
  13830. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/qt.png
  13831. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarCenter.png
  13832. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarLeft.png
  13833. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mainwindow/titlebarRight.png
  13834. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/copy.png
  13835. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/cut.png
  13836. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/new.png
  13837. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/open.png
  13838. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/paste.png
  13839. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/mdi/images/save.png
  13840. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/copy.png
  13841. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/cut.png
  13842. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/new.png
  13843. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/open.png
  13844. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/paste.png
  13845. share/doc/qt5/qtwidgets/images/used-in-examples/mainwindows/sdi/images/save.png
  13846. share/doc/qt5/qtwidgets/images/used-in-examples/painting/affine/bg1.jpg
  13847. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/brick.png
  13848. share/doc/qt5/qtwidgets/images/used-in-examples/painting/basicdrawing/images/qt-logo.png
  13849. share/doc/qt5/qtwidgets/images/used-in-examples/painting/composition/flower.jpg
  13850. share/doc/qt5/qtwidgets/images/used-in-examples/painting/composition/flower_alpha.jpg
  13851. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/background.png
  13852. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/blackrectangle.png
  13853. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/butterfly.png
  13854. share/doc/qt5/qtwidgets/images/used-in-examples/painting/imagecomposition/images/checker.png
  13855. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/logo32.png
  13856. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcopy.png
  13857. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editcut.png
  13858. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editpaste.png
  13859. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editredo.png
  13860. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/editundo.png
  13861. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/exportpdf.png
  13862. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filenew.png
  13863. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileopen.png
  13864. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/fileprint.png
  13865. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/filesave.png
  13866. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textbold.png
  13867. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textcenter.png
  13868. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textitalic.png
  13869. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textjustify.png
  13870. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textleft.png
  13871. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textright.png
  13872. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/textunder.png
  13873. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomin.png
  13874. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/mac/zoomout.png
  13875. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcopy.png
  13876. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editcut.png
  13877. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editpaste.png
  13878. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editredo.png
  13879. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/editundo.png
  13880. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/exportpdf.png
  13881. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filenew.png
  13882. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileopen.png
  13883. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/fileprint.png
  13884. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/filesave.png
  13885. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textbold.png
  13886. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textcenter.png
  13887. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textitalic.png
  13888. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textjustify.png
  13889. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textleft.png
  13890. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textright.png
  13891. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/textunder.png
  13892. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomin.png
  13893. share/doc/qt5/qtwidgets/images/used-in-examples/richtext/textedit/images/win/zoomout.png
  13894. share/doc/qt5/qtwidgets/images/used-in-examples/tools/codecs/images/editcopy.png
  13895. share/doc/qt5/qtwidgets/images/used-in-examples/tools/regularexpression/images/copy.png
  13896. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/background.png
  13897. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/blue.png
  13898. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/circle.png
  13899. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/exit.png
  13900. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/fileclose.png
  13901. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/filenew.png
  13902. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/fileopen.png
  13903. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/filesave.png
  13904. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/green.png
  13905. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/ok.png
  13906. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/rectangle.png
  13907. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/red.png
  13908. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/redo.png
  13909. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/remove.png
  13910. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/triangle.png
  13911. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undo/icons/undo.png
  13912. share/doc/qt5/qtwidgets/images/used-in-examples/tools/undoframework/images/cross.png
  13913. share/doc/qt5/qtwidgets/images/used-in-examples/touch/pinchzoom/images/cheese.jpg
  13914. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/bold.png
  13915. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/copy.png
  13916. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/create.png
  13917. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/cut.png
  13918. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/edit_redo.png
  13919. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/edit_undo.png
  13920. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/exit.png
  13921. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/font.png
  13922. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/info.png
  13923. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/italic.png
  13924. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/new.png
  13925. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/open.png
  13926. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/paste.png
  13927. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/pencil.png
  13928. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/print.png
  13929. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/save.png
  13930. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/save_as.png
  13931. share/doc/qt5/qtwidgets/images/used-in-examples/tutorials/notepad/images/underline.png
  13932. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/designer.png
  13933. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_disabled.png
  13934. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/find_normal.png
  13935. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_128x128.png
  13936. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_16x16.png
  13937. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_32x32.png
  13938. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_off_64x64.png
  13939. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_128x128.png
  13940. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_16x16.png
  13941. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_32x32.png
  13942. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/monkey_on_64x64.png
  13943. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_16x16.png
  13944. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_32x32.png
  13945. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/icons/images/qt_extended_48x48.png
  13946. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/movie/animation.gif
  13947. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbackground.png
  13948. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/styles/images/woodbutton.png
  13949. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked.png
  13950. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_hover.png
  13951. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_checked_pressed.png
  13952. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked.png
  13953. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_hover.png
  13954. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/checkbox_unchecked_pressed.png
  13955. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow.png
  13956. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/down_arrow_disabled.png
  13957. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/frame.png
  13958. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pagefold.png
  13959. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton.png
  13960. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_hover.png
  13961. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/pushbutton_pressed.png
  13962. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked.png
  13963. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_hover.png
  13964. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_checked_pressed.png
  13965. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked.png
  13966. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_hover.png
  13967. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/radiobutton_unchecked_pressed.png
  13968. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/sizegrip.png
  13969. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown.png
  13970. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_hover.png
  13971. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_off.png
  13972. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spindown_pressed.png
  13973. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup.png
  13974. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_hover.png
  13975. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_off.png
  13976. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/spinup_pressed.png
  13977. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow.png
  13978. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/stylesheet/images/up_arrow_disabled.png
  13979. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-airbrush.png
  13980. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-eraser.png
  13981. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-felt-marker.png
  13982. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tablet/images/cursor-pencil.png
  13983. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/circle.png
  13984. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/square.png
  13985. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/tooltips/images/triangle.png
  13986. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/validators/ledoff.png
  13987. share/doc/qt5/qtwidgets/images/used-in-examples/widgets/validators/ledon.png
  13988. share/doc/qt5/qtwidgets/images/validators.png
  13989. share/doc/qt5/qtwidgets/images/weatheranchorlayout-example.png
  13990. share/doc/qt5/qtwidgets/images/whatsthis.png
  13991. share/doc/qt5/qtwidgets/images/widget-examples.png
  13992. share/doc/qt5/qtwidgets/images/widgetdelegate.png
  13993. share/doc/qt5/qtwidgets/images/widgetmapper-combo-mapping.png
  13994. share/doc/qt5/qtwidgets/images/widgetmapper-simple-mapping.png
  13995. share/doc/qt5/qtwidgets/images/widgetmapper.png
  13996. share/doc/qt5/qtwidgets/images/widgets-tutorial-childwidget.png
  13997. share/doc/qt5/qtwidgets/images/widgets-tutorial-nestedlayouts.png
  13998. share/doc/qt5/qtwidgets/images/widgets-tutorial-toplevel.png
  13999. share/doc/qt5/qtwidgets/images/widgets-tutorial-windowlayout.png
  14000. share/doc/qt5/qtwidgets/images/wiggly-example.png
  14001. share/doc/qt5/qtwidgets/images/windowflags-example.png
  14002. share/doc/qt5/qtwidgets/images/windowflags_controllerwindow.png
  14003. share/doc/qt5/qtwidgets/images/windowflags_previewwindow.png
  14004. share/doc/qt5/qtwidgets/images/windows-checkbox.png
  14005. share/doc/qt5/qtwidgets/images/windows-combobox.png
  14006. share/doc/qt5/qtwidgets/images/windows-dateedit.png
  14007. share/doc/qt5/qtwidgets/images/windows-datetimeedit.png
  14008. share/doc/qt5/qtwidgets/images/windows-dial.png
  14009. share/doc/qt5/qtwidgets/images/windows-groupbox.png
  14010. share/doc/qt5/qtwidgets/images/windows-label.png
  14011. share/doc/qt5/qtwidgets/images/windows-lcdnumber.png
  14012. share/doc/qt5/qtwidgets/images/windows-lineedit.png
  14013. share/doc/qt5/qtwidgets/images/windows-listview.png
  14014. share/doc/qt5/qtwidgets/images/windows-progressbar.png
  14015. share/doc/qt5/qtwidgets/images/windows-pushbutton.png
  14016. share/doc/qt5/qtwidgets/images/windows-radiobutton.png
  14017. share/doc/qt5/qtwidgets/images/windows-slider.png
  14018. share/doc/qt5/qtwidgets/images/windows-spinbox.png
  14019. share/doc/qt5/qtwidgets/images/windows-style.png
  14020. share/doc/qt5/qtwidgets/images/windows-style2.png
  14021. share/doc/qt5/qtwidgets/images/windows-tableview.png
  14022. share/doc/qt5/qtwidgets/images/windows-tabwidget.png
  14023. share/doc/qt5/qtwidgets/images/windows-timeedit.png
  14024. share/doc/qt5/qtwidgets/images/windows-treeview.png
  14025. share/doc/qt5/qtwidgets/images/windows-vista-style.png
  14026. share/doc/qt5/qtwidgets/images/windowstabimage.png
  14027. share/doc/qt5/qtwidgets/images/windowsvista-fontcombobox.png
  14028. share/doc/qt5/qtwidgets/images/windowsvista-pushbutton.png
  14029. share/doc/qt5/qtwidgets/images/windowsvista-radiobutton.png
  14030. share/doc/qt5/qtwidgets/images/windowsvista-tabwidget.png
  14031. share/doc/qt5/qtwidgets/images/woodbackground.png
  14032. share/doc/qt5/qtwidgets/images/woodbutton.png
  14033. share/doc/qt5/qtwidgets/layout.html
  14034. share/doc/qt5/qtwidgets/mainwindow.html
  14035. share/doc/qt5/qtwidgets/model-view-programming.html
  14036. share/doc/qt5/qtwidgets/modelview-part2-main-cpp.html
  14037. share/doc/qt5/qtwidgets/modelview.html
  14038. share/doc/qt5/qtwidgets/qabstractbutton-members.html
  14039. share/doc/qt5/qtwidgets/qabstractbutton-obsolete.html
  14040. share/doc/qt5/qtwidgets/qabstractbutton.html
  14041. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem-members.html
  14042. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem-obsolete.html
  14043. share/doc/qt5/qtwidgets/qabstractgraphicsshapeitem.html
  14044. share/doc/qt5/qtwidgets/qabstractitemdelegate-members.html
  14045. share/doc/qt5/qtwidgets/qabstractitemdelegate-obsolete.html
  14046. share/doc/qt5/qtwidgets/qabstractitemdelegate.html
  14047. share/doc/qt5/qtwidgets/qabstractitemview-members.html
  14048. share/doc/qt5/qtwidgets/qabstractitemview-obsolete.html
  14049. share/doc/qt5/qtwidgets/qabstractitemview.html
  14050. share/doc/qt5/qtwidgets/qabstractscrollarea-members.html
  14051. share/doc/qt5/qtwidgets/qabstractscrollarea-obsolete.html
  14052. share/doc/qt5/qtwidgets/qabstractscrollarea.html
  14053. share/doc/qt5/qtwidgets/qabstractslider-members.html
  14054. share/doc/qt5/qtwidgets/qabstractslider-obsolete.html
  14055. share/doc/qt5/qtwidgets/qabstractslider.html
  14056. share/doc/qt5/qtwidgets/qabstractspinbox-members.html
  14057. share/doc/qt5/qtwidgets/qabstractspinbox-obsolete.html
  14058. share/doc/qt5/qtwidgets/qabstractspinbox.html
  14059. share/doc/qt5/qtwidgets/qaccessiblewidget-members.html
  14060. share/doc/qt5/qtwidgets/qaccessiblewidget.html
  14061. share/doc/qt5/qtwidgets/qaction-members.html
  14062. share/doc/qt5/qtwidgets/qaction-obsolete.html
  14063. share/doc/qt5/qtwidgets/qaction.html
  14064. share/doc/qt5/qtwidgets/qactiongroup-members.html
  14065. share/doc/qt5/qtwidgets/qactiongroup-obsolete.html
  14066. share/doc/qt5/qtwidgets/qactiongroup.html
  14067. share/doc/qt5/qtwidgets/qapplication-members.html
  14068. share/doc/qt5/qtwidgets/qapplication-obsolete.html
  14069. share/doc/qt5/qtwidgets/qapplication.html
  14070. share/doc/qt5/qtwidgets/qboxlayout-members.html
  14071. share/doc/qt5/qtwidgets/qboxlayout-obsolete.html
  14072. share/doc/qt5/qtwidgets/qboxlayout.html
  14073. share/doc/qt5/qtwidgets/qbuttongroup-members.html
  14074. share/doc/qt5/qtwidgets/qbuttongroup-obsolete.html
  14075. share/doc/qt5/qtwidgets/qbuttongroup.html
  14076. share/doc/qt5/qtwidgets/qcalendarwidget-members.html
  14077. share/doc/qt5/qtwidgets/qcalendarwidget-obsolete.html
  14078. share/doc/qt5/qtwidgets/qcalendarwidget.html
  14079. share/doc/qt5/qtwidgets/qcheckbox-members.html
  14080. share/doc/qt5/qtwidgets/qcheckbox-obsolete.html
  14081. share/doc/qt5/qtwidgets/qcheckbox.html
  14082. share/doc/qt5/qtwidgets/qcolordialog-members.html
  14083. share/doc/qt5/qtwidgets/qcolordialog-obsolete.html
  14084. share/doc/qt5/qtwidgets/qcolordialog.html
  14085. share/doc/qt5/qtwidgets/qcolormap-members.html
  14086. share/doc/qt5/qtwidgets/qcolormap.html
  14087. share/doc/qt5/qtwidgets/qcolumnview-members.html
  14088. share/doc/qt5/qtwidgets/qcolumnview-obsolete.html
  14089. share/doc/qt5/qtwidgets/qcolumnview.html
  14090. share/doc/qt5/qtwidgets/qcombobox-members.html
  14091. share/doc/qt5/qtwidgets/qcombobox-obsolete.html
  14092. share/doc/qt5/qtwidgets/qcombobox.html
  14093. share/doc/qt5/qtwidgets/qcommandlinkbutton-members.html
  14094. share/doc/qt5/qtwidgets/qcommandlinkbutton-obsolete.html
  14095. share/doc/qt5/qtwidgets/qcommandlinkbutton.html
  14096. share/doc/qt5/qtwidgets/qcommonstyle-members.html
  14097. share/doc/qt5/qtwidgets/qcommonstyle-obsolete.html
  14098. share/doc/qt5/qtwidgets/qcommonstyle.html
  14099. share/doc/qt5/qtwidgets/qcompleter-members.html
  14100. share/doc/qt5/qtwidgets/qcompleter-obsolete.html
  14101. share/doc/qt5/qtwidgets/qcompleter.html
  14102. share/doc/qt5/qtwidgets/qdatawidgetmapper-members.html
  14103. share/doc/qt5/qtwidgets/qdatawidgetmapper-obsolete.html
  14104. share/doc/qt5/qtwidgets/qdatawidgetmapper.html
  14105. share/doc/qt5/qtwidgets/qdateedit-members.html
  14106. share/doc/qt5/qtwidgets/qdateedit-obsolete.html
  14107. share/doc/qt5/qtwidgets/qdateedit.html
  14108. share/doc/qt5/qtwidgets/qdatetimeedit-members.html
  14109. share/doc/qt5/qtwidgets/qdatetimeedit-obsolete.html
  14110. share/doc/qt5/qtwidgets/qdatetimeedit.html
  14111. share/doc/qt5/qtwidgets/qdesktopwidget-members.html
  14112. share/doc/qt5/qtwidgets/qdesktopwidget-obsolete.html
  14113. share/doc/qt5/qtwidgets/qdesktopwidget.html
  14114. share/doc/qt5/qtwidgets/qdial-members.html
  14115. share/doc/qt5/qtwidgets/qdial-obsolete.html
  14116. share/doc/qt5/qtwidgets/qdial.html
  14117. share/doc/qt5/qtwidgets/qdialog-members.html
  14118. share/doc/qt5/qtwidgets/qdialog-obsolete.html
  14119. share/doc/qt5/qtwidgets/qdialog.html
  14120. share/doc/qt5/qtwidgets/qdialogbuttonbox-members.html
  14121. share/doc/qt5/qtwidgets/qdialogbuttonbox-obsolete.html
  14122. share/doc/qt5/qtwidgets/qdialogbuttonbox.html
  14123. share/doc/qt5/qtwidgets/qdirmodel-members.html
  14124. share/doc/qt5/qtwidgets/qdirmodel-obsolete.html
  14125. share/doc/qt5/qtwidgets/qdirmodel.html
  14126. share/doc/qt5/qtwidgets/qdockwidget-members.html
  14127. share/doc/qt5/qtwidgets/qdockwidget-obsolete.html
  14128. share/doc/qt5/qtwidgets/qdockwidget.html
  14129. share/doc/qt5/qtwidgets/qdoublespinbox-members.html
  14130. share/doc/qt5/qtwidgets/qdoublespinbox-obsolete.html
  14131. share/doc/qt5/qtwidgets/qdoublespinbox.html
  14132. share/doc/qt5/qtwidgets/qdrawutil-h.html
  14133. share/doc/qt5/qtwidgets/qerrormessage-members.html
  14134. share/doc/qt5/qtwidgets/qerrormessage-obsolete.html
  14135. share/doc/qt5/qtwidgets/qerrormessage.html
  14136. share/doc/qt5/qtwidgets/qfiledialog-members.html
  14137. share/doc/qt5/qtwidgets/qfiledialog-obsolete.html
  14138. share/doc/qt5/qtwidgets/qfiledialog.html
  14139. share/doc/qt5/qtwidgets/qfileiconprovider-members.html
  14140. share/doc/qt5/qtwidgets/qfileiconprovider.html
  14141. share/doc/qt5/qtwidgets/qfilesystemmodel-members.html
  14142. share/doc/qt5/qtwidgets/qfilesystemmodel-obsolete.html
  14143. share/doc/qt5/qtwidgets/qfilesystemmodel.html
  14144. share/doc/qt5/qtwidgets/qfocusframe-members.html
  14145. share/doc/qt5/qtwidgets/qfocusframe-obsolete.html
  14146. share/doc/qt5/qtwidgets/qfocusframe.html
  14147. share/doc/qt5/qtwidgets/qfontcombobox-members.html
  14148. share/doc/qt5/qtwidgets/qfontcombobox-obsolete.html
  14149. share/doc/qt5/qtwidgets/qfontcombobox.html
  14150. share/doc/qt5/qtwidgets/qfontdialog-members.html
  14151. share/doc/qt5/qtwidgets/qfontdialog-obsolete.html
  14152. share/doc/qt5/qtwidgets/qfontdialog.html
  14153. share/doc/qt5/qtwidgets/qformlayout-members.html
  14154. share/doc/qt5/qtwidgets/qformlayout-obsolete.html
  14155. share/doc/qt5/qtwidgets/qformlayout-takerowresult-members.html
  14156. share/doc/qt5/qtwidgets/qformlayout-takerowresult.html
  14157. share/doc/qt5/qtwidgets/qformlayout.html
  14158. share/doc/qt5/qtwidgets/qframe-members.html
  14159. share/doc/qt5/qtwidgets/qframe-obsolete.html
  14160. share/doc/qt5/qtwidgets/qframe.html
  14161. share/doc/qt5/qtwidgets/qgesture-members.html
  14162. share/doc/qt5/qtwidgets/qgesture-obsolete.html
  14163. share/doc/qt5/qtwidgets/qgesture.html
  14164. share/doc/qt5/qtwidgets/qgestureevent-members.html
  14165. share/doc/qt5/qtwidgets/qgestureevent.html
  14166. share/doc/qt5/qtwidgets/qgesturerecognizer-members.html
  14167. share/doc/qt5/qtwidgets/qgesturerecognizer.html
  14168. share/doc/qt5/qtwidgets/qgraphicsanchor-members.html
  14169. share/doc/qt5/qtwidgets/qgraphicsanchor-obsolete.html
  14170. share/doc/qt5/qtwidgets/qgraphicsanchor.html
  14171. share/doc/qt5/qtwidgets/qgraphicsanchorlayout-members.html
  14172. share/doc/qt5/qtwidgets/qgraphicsanchorlayout.html
  14173. share/doc/qt5/qtwidgets/qgraphicsblureffect-members.html
  14174. share/doc/qt5/qtwidgets/qgraphicsblureffect-obsolete.html
  14175. share/doc/qt5/qtwidgets/qgraphicsblureffect.html
  14176. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect-members.html
  14177. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect-obsolete.html
  14178. share/doc/qt5/qtwidgets/qgraphicscolorizeeffect.html
  14179. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect-members.html
  14180. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect-obsolete.html
  14181. share/doc/qt5/qtwidgets/qgraphicsdropshadoweffect.html
  14182. share/doc/qt5/qtwidgets/qgraphicseffect-members.html
  14183. share/doc/qt5/qtwidgets/qgraphicseffect-obsolete.html
  14184. share/doc/qt5/qtwidgets/qgraphicseffect.html
  14185. share/doc/qt5/qtwidgets/qgraphicsellipseitem-members.html
  14186. share/doc/qt5/qtwidgets/qgraphicsellipseitem-obsolete.html
  14187. share/doc/qt5/qtwidgets/qgraphicsellipseitem.html
  14188. share/doc/qt5/qtwidgets/qgraphicsgridlayout-members.html
  14189. share/doc/qt5/qtwidgets/qgraphicsgridlayout.html
  14190. share/doc/qt5/qtwidgets/qgraphicsitem-members.html
  14191. share/doc/qt5/qtwidgets/qgraphicsitem-obsolete.html
  14192. share/doc/qt5/qtwidgets/qgraphicsitem.html
  14193. share/doc/qt5/qtwidgets/qgraphicsitemanimation-members.html
  14194. share/doc/qt5/qtwidgets/qgraphicsitemanimation-obsolete.html
  14195. share/doc/qt5/qtwidgets/qgraphicsitemanimation.html
  14196. share/doc/qt5/qtwidgets/qgraphicsitemgroup-members.html
  14197. share/doc/qt5/qtwidgets/qgraphicsitemgroup-obsolete.html
  14198. share/doc/qt5/qtwidgets/qgraphicsitemgroup.html
  14199. share/doc/qt5/qtwidgets/qgraphicslayout-members.html
  14200. share/doc/qt5/qtwidgets/qgraphicslayout.html
  14201. share/doc/qt5/qtwidgets/qgraphicslayoutitem-members.html
  14202. share/doc/qt5/qtwidgets/qgraphicslayoutitem.html
  14203. share/doc/qt5/qtwidgets/qgraphicslinearlayout-members.html
  14204. share/doc/qt5/qtwidgets/qgraphicslinearlayout.html
  14205. share/doc/qt5/qtwidgets/qgraphicslineitem-members.html
  14206. share/doc/qt5/qtwidgets/qgraphicslineitem-obsolete.html
  14207. share/doc/qt5/qtwidgets/qgraphicslineitem.html
  14208. share/doc/qt5/qtwidgets/qgraphicsobject-members.html
  14209. share/doc/qt5/qtwidgets/qgraphicsobject-obsolete.html
  14210. share/doc/qt5/qtwidgets/qgraphicsobject.html
  14211. share/doc/qt5/qtwidgets/qgraphicsopacityeffect-members.html
  14212. share/doc/qt5/qtwidgets/qgraphicsopacityeffect-obsolete.html
  14213. share/doc/qt5/qtwidgets/qgraphicsopacityeffect.html
  14214. share/doc/qt5/qtwidgets/qgraphicspathitem-members.html
  14215. share/doc/qt5/qtwidgets/qgraphicspathitem-obsolete.html
  14216. share/doc/qt5/qtwidgets/qgraphicspathitem.html
  14217. share/doc/qt5/qtwidgets/qgraphicspixmapitem-members.html
  14218. share/doc/qt5/qtwidgets/qgraphicspixmapitem-obsolete.html
  14219. share/doc/qt5/qtwidgets/qgraphicspixmapitem.html
  14220. share/doc/qt5/qtwidgets/qgraphicspolygonitem-members.html
  14221. share/doc/qt5/qtwidgets/qgraphicspolygonitem-obsolete.html
  14222. share/doc/qt5/qtwidgets/qgraphicspolygonitem.html
  14223. share/doc/qt5/qtwidgets/qgraphicsproxywidget-members.html
  14224. share/doc/qt5/qtwidgets/qgraphicsproxywidget-obsolete.html
  14225. share/doc/qt5/qtwidgets/qgraphicsproxywidget.html
  14226. share/doc/qt5/qtwidgets/qgraphicsrectitem-members.html
  14227. share/doc/qt5/qtwidgets/qgraphicsrectitem-obsolete.html
  14228. share/doc/qt5/qtwidgets/qgraphicsrectitem.html
  14229. share/doc/qt5/qtwidgets/qgraphicsrotation-members.html
  14230. share/doc/qt5/qtwidgets/qgraphicsrotation-obsolete.html
  14231. share/doc/qt5/qtwidgets/qgraphicsrotation.html
  14232. share/doc/qt5/qtwidgets/qgraphicsscale-members.html
  14233. share/doc/qt5/qtwidgets/qgraphicsscale-obsolete.html
  14234. share/doc/qt5/qtwidgets/qgraphicsscale.html
  14235. share/doc/qt5/qtwidgets/qgraphicsscene-members.html
  14236. share/doc/qt5/qtwidgets/qgraphicsscene-obsolete.html
  14237. share/doc/qt5/qtwidgets/qgraphicsscene.html
  14238. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent-members.html
  14239. share/doc/qt5/qtwidgets/qgraphicsscenecontextmenuevent.html
  14240. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent-members.html
  14241. share/doc/qt5/qtwidgets/qgraphicsscenedragdropevent.html
  14242. share/doc/qt5/qtwidgets/qgraphicssceneevent-members.html
  14243. share/doc/qt5/qtwidgets/qgraphicssceneevent.html
  14244. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent-members.html
  14245. share/doc/qt5/qtwidgets/qgraphicsscenehelpevent.html
  14246. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent-members.html
  14247. share/doc/qt5/qtwidgets/qgraphicsscenehoverevent.html
  14248. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent-members.html
  14249. share/doc/qt5/qtwidgets/qgraphicsscenemouseevent.html
  14250. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent-members.html
  14251. share/doc/qt5/qtwidgets/qgraphicsscenemoveevent.html
  14252. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent-members.html
  14253. share/doc/qt5/qtwidgets/qgraphicssceneresizeevent.html
  14254. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent-members.html
  14255. share/doc/qt5/qtwidgets/qgraphicsscenewheelevent.html
  14256. share/doc/qt5/qtwidgets/qgraphicssimpletextitem-members.html
  14257. share/doc/qt5/qtwidgets/qgraphicssimpletextitem-obsolete.html
  14258. share/doc/qt5/qtwidgets/qgraphicssimpletextitem.html
  14259. share/doc/qt5/qtwidgets/qgraphicstextitem-members.html
  14260. share/doc/qt5/qtwidgets/qgraphicstextitem-obsolete.html
  14261. share/doc/qt5/qtwidgets/qgraphicstextitem.html
  14262. share/doc/qt5/qtwidgets/qgraphicstransform-members.html
  14263. share/doc/qt5/qtwidgets/qgraphicstransform-obsolete.html
  14264. share/doc/qt5/qtwidgets/qgraphicstransform.html
  14265. share/doc/qt5/qtwidgets/qgraphicsview-members.html
  14266. share/doc/qt5/qtwidgets/qgraphicsview-obsolete.html
  14267. share/doc/qt5/qtwidgets/qgraphicsview.html
  14268. share/doc/qt5/qtwidgets/qgraphicswidget-members.html
  14269. share/doc/qt5/qtwidgets/qgraphicswidget-obsolete.html
  14270. share/doc/qt5/qtwidgets/qgraphicswidget.html
  14271. share/doc/qt5/qtwidgets/qgridlayout-members.html
  14272. share/doc/qt5/qtwidgets/qgridlayout-obsolete.html
  14273. share/doc/qt5/qtwidgets/qgridlayout.html
  14274. share/doc/qt5/qtwidgets/qgroupbox-members.html
  14275. share/doc/qt5/qtwidgets/qgroupbox-obsolete.html
  14276. share/doc/qt5/qtwidgets/qgroupbox.html
  14277. share/doc/qt5/qtwidgets/qhboxlayout-members.html
  14278. share/doc/qt5/qtwidgets/qhboxlayout-obsolete.html
  14279. share/doc/qt5/qtwidgets/qhboxlayout.html
  14280. share/doc/qt5/qtwidgets/qheaderview-members.html
  14281. share/doc/qt5/qtwidgets/qheaderview-obsolete.html
  14282. share/doc/qt5/qtwidgets/qheaderview.html
  14283. share/doc/qt5/qtwidgets/qinputdialog-members.html
  14284. share/doc/qt5/qtwidgets/qinputdialog-obsolete.html
  14285. share/doc/qt5/qtwidgets/qinputdialog.html
  14286. share/doc/qt5/qtwidgets/qitemdelegate-members.html
  14287. share/doc/qt5/qtwidgets/qitemdelegate-obsolete.html
  14288. share/doc/qt5/qtwidgets/qitemdelegate.html
  14289. share/doc/qt5/qtwidgets/qitemeditorcreator-members.html
  14290. share/doc/qt5/qtwidgets/qitemeditorcreator.html
  14291. share/doc/qt5/qtwidgets/qitemeditorcreatorbase-members.html
  14292. share/doc/qt5/qtwidgets/qitemeditorcreatorbase.html
  14293. share/doc/qt5/qtwidgets/qitemeditorfactory-members.html
  14294. share/doc/qt5/qtwidgets/qitemeditorfactory.html
  14295. share/doc/qt5/qtwidgets/qkeyeventtransition-members.html
  14296. share/doc/qt5/qtwidgets/qkeyeventtransition-obsolete.html
  14297. share/doc/qt5/qtwidgets/qkeyeventtransition.html
  14298. share/doc/qt5/qtwidgets/qkeysequenceedit-members.html
  14299. share/doc/qt5/qtwidgets/qkeysequenceedit-obsolete.html
  14300. share/doc/qt5/qtwidgets/qkeysequenceedit.html
  14301. share/doc/qt5/qtwidgets/qlabel-members.html
  14302. share/doc/qt5/qtwidgets/qlabel-obsolete.html
  14303. share/doc/qt5/qtwidgets/qlabel.html
  14304. share/doc/qt5/qtwidgets/qlayout-members.html
  14305. share/doc/qt5/qtwidgets/qlayout-obsolete.html
  14306. share/doc/qt5/qtwidgets/qlayout.html
  14307. share/doc/qt5/qtwidgets/qlayoutitem-members.html
  14308. share/doc/qt5/qtwidgets/qlayoutitem.html
  14309. share/doc/qt5/qtwidgets/qlcdnumber-members.html
  14310. share/doc/qt5/qtwidgets/qlcdnumber-obsolete.html
  14311. share/doc/qt5/qtwidgets/qlcdnumber.html
  14312. share/doc/qt5/qtwidgets/qlineedit-members.html
  14313. share/doc/qt5/qtwidgets/qlineedit-obsolete.html
  14314. share/doc/qt5/qtwidgets/qlineedit.html
  14315. share/doc/qt5/qtwidgets/qlistview-members.html
  14316. share/doc/qt5/qtwidgets/qlistview-obsolete.html
  14317. share/doc/qt5/qtwidgets/qlistview.html
  14318. share/doc/qt5/qtwidgets/qlistwidget-members.html
  14319. share/doc/qt5/qtwidgets/qlistwidget-obsolete.html
  14320. share/doc/qt5/qtwidgets/qlistwidget.html
  14321. share/doc/qt5/qtwidgets/qlistwidgetitem-members.html
  14322. share/doc/qt5/qtwidgets/qlistwidgetitem-obsolete.html
  14323. share/doc/qt5/qtwidgets/qlistwidgetitem.html
  14324. share/doc/qt5/qtwidgets/qmainwindow-members.html
  14325. share/doc/qt5/qtwidgets/qmainwindow-obsolete.html
  14326. share/doc/qt5/qtwidgets/qmainwindow.html
  14327. share/doc/qt5/qtwidgets/qmdiarea-members.html
  14328. share/doc/qt5/qtwidgets/qmdiarea-obsolete.html
  14329. share/doc/qt5/qtwidgets/qmdiarea.html
  14330. share/doc/qt5/qtwidgets/qmdisubwindow-members.html
  14331. share/doc/qt5/qtwidgets/qmdisubwindow-obsolete.html
  14332. share/doc/qt5/qtwidgets/qmdisubwindow.html
  14333. share/doc/qt5/qtwidgets/qmenu-members.html
  14334. share/doc/qt5/qtwidgets/qmenu-obsolete.html
  14335. share/doc/qt5/qtwidgets/qmenu.html
  14336. share/doc/qt5/qtwidgets/qmenubar-members.html
  14337. share/doc/qt5/qtwidgets/qmenubar-obsolete.html
  14338. share/doc/qt5/qtwidgets/qmenubar.html
  14339. share/doc/qt5/qtwidgets/qmessagebox-members.html
  14340. share/doc/qt5/qtwidgets/qmessagebox-obsolete.html
  14341. share/doc/qt5/qtwidgets/qmessagebox.html
  14342. share/doc/qt5/qtwidgets/qmouseeventtransition-members.html
  14343. share/doc/qt5/qtwidgets/qmouseeventtransition-obsolete.html
  14344. share/doc/qt5/qtwidgets/qmouseeventtransition.html
  14345. share/doc/qt5/qtwidgets/qopenglwidget-members.html
  14346. share/doc/qt5/qtwidgets/qopenglwidget-obsolete.html
  14347. share/doc/qt5/qtwidgets/qopenglwidget.html
  14348. share/doc/qt5/qtwidgets/qpangesture-members.html
  14349. share/doc/qt5/qtwidgets/qpangesture-obsolete.html
  14350. share/doc/qt5/qtwidgets/qpangesture.html
  14351. share/doc/qt5/qtwidgets/qpinchgesture-members.html
  14352. share/doc/qt5/qtwidgets/qpinchgesture-obsolete.html
  14353. share/doc/qt5/qtwidgets/qpinchgesture.html
  14354. share/doc/qt5/qtwidgets/qplaintextdocumentlayout-members.html
  14355. share/doc/qt5/qtwidgets/qplaintextdocumentlayout-obsolete.html
  14356. share/doc/qt5/qtwidgets/qplaintextdocumentlayout.html
  14357. share/doc/qt5/qtwidgets/qplaintextedit-members.html
  14358. share/doc/qt5/qtwidgets/qplaintextedit-obsolete.html
  14359. share/doc/qt5/qtwidgets/qplaintextedit.html
  14360. share/doc/qt5/qtwidgets/qprogressbar-members.html
  14361. share/doc/qt5/qtwidgets/qprogressbar-obsolete.html
  14362. share/doc/qt5/qtwidgets/qprogressbar.html
  14363. share/doc/qt5/qtwidgets/qprogressdialog-members.html
  14364. share/doc/qt5/qtwidgets/qprogressdialog-obsolete.html
  14365. share/doc/qt5/qtwidgets/qprogressdialog.html
  14366. share/doc/qt5/qtwidgets/qproxystyle-members.html
  14367. share/doc/qt5/qtwidgets/qproxystyle-obsolete.html
  14368. share/doc/qt5/qtwidgets/qproxystyle.html
  14369. share/doc/qt5/qtwidgets/qpushbutton-members.html
  14370. share/doc/qt5/qtwidgets/qpushbutton-obsolete.html
  14371. share/doc/qt5/qtwidgets/qpushbutton.html
  14372. share/doc/qt5/qtwidgets/qradiobutton-members.html
  14373. share/doc/qt5/qtwidgets/qradiobutton-obsolete.html
  14374. share/doc/qt5/qtwidgets/qradiobutton.html
  14375. share/doc/qt5/qtwidgets/qrubberband-members.html
  14376. share/doc/qt5/qtwidgets/qrubberband-obsolete.html
  14377. share/doc/qt5/qtwidgets/qrubberband.html
  14378. share/doc/qt5/qtwidgets/qscrollarea-members.html
  14379. share/doc/qt5/qtwidgets/qscrollarea-obsolete.html
  14380. share/doc/qt5/qtwidgets/qscrollarea.html
  14381. share/doc/qt5/qtwidgets/qscrollbar-members.html
  14382. share/doc/qt5/qtwidgets/qscrollbar-obsolete.html
  14383. share/doc/qt5/qtwidgets/qscrollbar.html
  14384. share/doc/qt5/qtwidgets/qscroller-members.html
  14385. share/doc/qt5/qtwidgets/qscroller-obsolete.html
  14386. share/doc/qt5/qtwidgets/qscroller.html
  14387. share/doc/qt5/qtwidgets/qscrollerproperties-members.html
  14388. share/doc/qt5/qtwidgets/qscrollerproperties.html
  14389. share/doc/qt5/qtwidgets/qshortcut-members.html
  14390. share/doc/qt5/qtwidgets/qshortcut-obsolete.html
  14391. share/doc/qt5/qtwidgets/qshortcut.html
  14392. share/doc/qt5/qtwidgets/qsizegrip-members.html
  14393. share/doc/qt5/qtwidgets/qsizegrip-obsolete.html
  14394. share/doc/qt5/qtwidgets/qsizegrip.html
  14395. share/doc/qt5/qtwidgets/qsizepolicy-members.html
  14396. share/doc/qt5/qtwidgets/qsizepolicy.html
  14397. share/doc/qt5/qtwidgets/qslider-members.html
  14398. share/doc/qt5/qtwidgets/qslider-obsolete.html
  14399. share/doc/qt5/qtwidgets/qslider.html
  14400. share/doc/qt5/qtwidgets/qspaceritem-members.html
  14401. share/doc/qt5/qtwidgets/qspaceritem.html
  14402. share/doc/qt5/qtwidgets/qspinbox-members.html
  14403. share/doc/qt5/qtwidgets/qspinbox-obsolete.html
  14404. share/doc/qt5/qtwidgets/qspinbox.html
  14405. share/doc/qt5/qtwidgets/qsplashscreen-members.html
  14406. share/doc/qt5/qtwidgets/qsplashscreen-obsolete.html
  14407. share/doc/qt5/qtwidgets/qsplashscreen.html
  14408. share/doc/qt5/qtwidgets/qsplitter-members.html
  14409. share/doc/qt5/qtwidgets/qsplitter-obsolete.html
  14410. share/doc/qt5/qtwidgets/qsplitter.html
  14411. share/doc/qt5/qtwidgets/qsplitterhandle-members.html
  14412. share/doc/qt5/qtwidgets/qsplitterhandle-obsolete.html
  14413. share/doc/qt5/qtwidgets/qsplitterhandle.html
  14414. share/doc/qt5/qtwidgets/qstackedlayout-members.html
  14415. share/doc/qt5/qtwidgets/qstackedlayout-obsolete.html
  14416. share/doc/qt5/qtwidgets/qstackedlayout.html
  14417. share/doc/qt5/qtwidgets/qstackedwidget-members.html
  14418. share/doc/qt5/qtwidgets/qstackedwidget-obsolete.html
  14419. share/doc/qt5/qtwidgets/qstackedwidget.html
  14420. share/doc/qt5/qtwidgets/qstandarditemeditorcreator-members.html
  14421. share/doc/qt5/qtwidgets/qstandarditemeditorcreator.html
  14422. share/doc/qt5/qtwidgets/qstatusbar-members.html
  14423. share/doc/qt5/qtwidgets/qstatusbar-obsolete.html
  14424. share/doc/qt5/qtwidgets/qstatusbar.html
  14425. share/doc/qt5/qtwidgets/qstyle-members.html
  14426. share/doc/qt5/qtwidgets/qstyle-obsolete.html
  14427. share/doc/qt5/qtwidgets/qstyle.html
  14428. share/doc/qt5/qtwidgets/qstyleditemdelegate-members.html
  14429. share/doc/qt5/qtwidgets/qstyleditemdelegate-obsolete.html
  14430. share/doc/qt5/qtwidgets/qstyleditemdelegate.html
  14431. share/doc/qt5/qtwidgets/qstylefactory-members.html
  14432. share/doc/qt5/qtwidgets/qstylefactory.html
  14433. share/doc/qt5/qtwidgets/qstylehintreturn-members.html
  14434. share/doc/qt5/qtwidgets/qstylehintreturn.html
  14435. share/doc/qt5/qtwidgets/qstylehintreturnmask-members.html
  14436. share/doc/qt5/qtwidgets/qstylehintreturnmask.html
  14437. share/doc/qt5/qtwidgets/qstylehintreturnvariant-members.html
  14438. share/doc/qt5/qtwidgets/qstylehintreturnvariant.html
  14439. share/doc/qt5/qtwidgets/qstyleoption-members.html
  14440. share/doc/qt5/qtwidgets/qstyleoption-obsolete.html
  14441. share/doc/qt5/qtwidgets/qstyleoption.html
  14442. share/doc/qt5/qtwidgets/qstyleoptionbutton-members.html
  14443. share/doc/qt5/qtwidgets/qstyleoptionbutton-obsolete.html
  14444. share/doc/qt5/qtwidgets/qstyleoptionbutton.html
  14445. share/doc/qt5/qtwidgets/qstyleoptioncombobox-members.html
  14446. share/doc/qt5/qtwidgets/qstyleoptioncombobox-obsolete.html
  14447. share/doc/qt5/qtwidgets/qstyleoptioncombobox.html
  14448. share/doc/qt5/qtwidgets/qstyleoptioncomplex-members.html
  14449. share/doc/qt5/qtwidgets/qstyleoptioncomplex-obsolete.html
  14450. share/doc/qt5/qtwidgets/qstyleoptioncomplex.html
  14451. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-members.html
  14452. share/doc/qt5/qtwidgets/qstyleoptiondockwidget-obsolete.html
  14453. share/doc/qt5/qtwidgets/qstyleoptiondockwidget.html
  14454. share/doc/qt5/qtwidgets/qstyleoptionfocusrect-members.html
  14455. share/doc/qt5/qtwidgets/qstyleoptionfocusrect-obsolete.html
  14456. share/doc/qt5/qtwidgets/qstyleoptionfocusrect.html
  14457. share/doc/qt5/qtwidgets/qstyleoptionframe-members.html
  14458. share/doc/qt5/qtwidgets/qstyleoptionframe-obsolete.html
  14459. share/doc/qt5/qtwidgets/qstyleoptionframe.html
  14460. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-members.html
  14461. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem-obsolete.html
  14462. share/doc/qt5/qtwidgets/qstyleoptiongraphicsitem.html
  14463. share/doc/qt5/qtwidgets/qstyleoptiongroupbox-members.html
  14464. share/doc/qt5/qtwidgets/qstyleoptiongroupbox-obsolete.html
  14465. share/doc/qt5/qtwidgets/qstyleoptiongroupbox.html
  14466. share/doc/qt5/qtwidgets/qstyleoptionheader-members.html
  14467. share/doc/qt5/qtwidgets/qstyleoptionheader-obsolete.html
  14468. share/doc/qt5/qtwidgets/qstyleoptionheader.html
  14469. share/doc/qt5/qtwidgets/qstyleoptionmenuitem-members.html
  14470. share/doc/qt5/qtwidgets/qstyleoptionmenuitem-obsolete.html
  14471. share/doc/qt5/qtwidgets/qstyleoptionmenuitem.html
  14472. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-members.html
  14473. share/doc/qt5/qtwidgets/qstyleoptionprogressbar-obsolete.html
  14474. share/doc/qt5/qtwidgets/qstyleoptionprogressbar.html
  14475. share/doc/qt5/qtwidgets/qstyleoptionrubberband-members.html
  14476. share/doc/qt5/qtwidgets/qstyleoptionrubberband-obsolete.html
  14477. share/doc/qt5/qtwidgets/qstyleoptionrubberband.html
  14478. share/doc/qt5/qtwidgets/qstyleoptionsizegrip-members.html
  14479. share/doc/qt5/qtwidgets/qstyleoptionsizegrip-obsolete.html
  14480. share/doc/qt5/qtwidgets/qstyleoptionsizegrip.html
  14481. share/doc/qt5/qtwidgets/qstyleoptionslider-members.html
  14482. share/doc/qt5/qtwidgets/qstyleoptionslider-obsolete.html
  14483. share/doc/qt5/qtwidgets/qstyleoptionslider.html
  14484. share/doc/qt5/qtwidgets/qstyleoptionspinbox-members.html
  14485. share/doc/qt5/qtwidgets/qstyleoptionspinbox-obsolete.html
  14486. share/doc/qt5/qtwidgets/qstyleoptionspinbox.html
  14487. share/doc/qt5/qtwidgets/qstyleoptiontab-members.html
  14488. share/doc/qt5/qtwidgets/qstyleoptiontab-obsolete.html
  14489. share/doc/qt5/qtwidgets/qstyleoptiontab.html
  14490. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-members.html
  14491. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase-obsolete.html
  14492. share/doc/qt5/qtwidgets/qstyleoptiontabbarbase.html
  14493. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-members.html
  14494. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe-obsolete.html
  14495. share/doc/qt5/qtwidgets/qstyleoptiontabwidgetframe.html
  14496. share/doc/qt5/qtwidgets/qstyleoptiontitlebar-members.html
  14497. share/doc/qt5/qtwidgets/qstyleoptiontitlebar-obsolete.html
  14498. share/doc/qt5/qtwidgets/qstyleoptiontitlebar.html
  14499. share/doc/qt5/qtwidgets/qstyleoptiontoolbar-members.html
  14500. share/doc/qt5/qtwidgets/qstyleoptiontoolbar-obsolete.html
  14501. share/doc/qt5/qtwidgets/qstyleoptiontoolbar.html
  14502. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-members.html
  14503. share/doc/qt5/qtwidgets/qstyleoptiontoolbox-obsolete.html
  14504. share/doc/qt5/qtwidgets/qstyleoptiontoolbox.html
  14505. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton-members.html
  14506. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton-obsolete.html
  14507. share/doc/qt5/qtwidgets/qstyleoptiontoolbutton.html
  14508. share/doc/qt5/qtwidgets/qstyleoptionviewitem-members.html
  14509. share/doc/qt5/qtwidgets/qstyleoptionviewitem-obsolete.html
  14510. share/doc/qt5/qtwidgets/qstyleoptionviewitem.html
  14511. share/doc/qt5/qtwidgets/qstylepainter-members.html
  14512. share/doc/qt5/qtwidgets/qstylepainter-obsolete.html
  14513. share/doc/qt5/qtwidgets/qstylepainter.html
  14514. share/doc/qt5/qtwidgets/qstyleplugin-members.html
  14515. share/doc/qt5/qtwidgets/qstyleplugin-obsolete.html
  14516. share/doc/qt5/qtwidgets/qstyleplugin.html
  14517. share/doc/qt5/qtwidgets/qswipegesture-members.html
  14518. share/doc/qt5/qtwidgets/qswipegesture-obsolete.html
  14519. share/doc/qt5/qtwidgets/qswipegesture.html
  14520. share/doc/qt5/qtwidgets/qsystemtrayicon-members.html
  14521. share/doc/qt5/qtwidgets/qsystemtrayicon-obsolete.html
  14522. share/doc/qt5/qtwidgets/qsystemtrayicon.html
  14523. share/doc/qt5/qtwidgets/qtabbar-members.html
  14524. share/doc/qt5/qtwidgets/qtabbar-obsolete.html
  14525. share/doc/qt5/qtwidgets/qtabbar.html
  14526. share/doc/qt5/qtwidgets/qtableview-members.html
  14527. share/doc/qt5/qtwidgets/qtableview-obsolete.html
  14528. share/doc/qt5/qtwidgets/qtableview.html
  14529. share/doc/qt5/qtwidgets/qtablewidget-members.html
  14530. share/doc/qt5/qtwidgets/qtablewidget-obsolete.html
  14531. share/doc/qt5/qtwidgets/qtablewidget.html
  14532. share/doc/qt5/qtwidgets/qtablewidgetitem-members.html
  14533. share/doc/qt5/qtwidgets/qtablewidgetitem-obsolete.html
  14534. share/doc/qt5/qtwidgets/qtablewidgetitem.html
  14535. share/doc/qt5/qtwidgets/qtablewidgetselectionrange-members.html
  14536. share/doc/qt5/qtwidgets/qtablewidgetselectionrange.html
  14537. share/doc/qt5/qtwidgets/qtabwidget-members.html
  14538. share/doc/qt5/qtwidgets/qtabwidget-obsolete.html
  14539. share/doc/qt5/qtwidgets/qtabwidget.html
  14540. share/doc/qt5/qtwidgets/qtapandholdgesture-members.html
  14541. share/doc/qt5/qtwidgets/qtapandholdgesture-obsolete.html
  14542. share/doc/qt5/qtwidgets/qtapandholdgesture.html
  14543. share/doc/qt5/qtwidgets/qtapgesture-members.html
  14544. share/doc/qt5/qtwidgets/qtapgesture-obsolete.html
  14545. share/doc/qt5/qtwidgets/qtapgesture.html
  14546. share/doc/qt5/qtwidgets/qtextbrowser-members.html
  14547. share/doc/qt5/qtwidgets/qtextbrowser-obsolete.html
  14548. share/doc/qt5/qtwidgets/qtextbrowser.html
  14549. share/doc/qt5/qtwidgets/qtextedit-extraselection-members.html
  14550. share/doc/qt5/qtwidgets/qtextedit-extraselection.html
  14551. share/doc/qt5/qtwidgets/qtextedit-members.html
  14552. share/doc/qt5/qtwidgets/qtextedit-obsolete.html
  14553. share/doc/qt5/qtwidgets/qtextedit.html
  14554. share/doc/qt5/qtwidgets/qtilerules-members.html
  14555. share/doc/qt5/qtwidgets/qtilerules.html
  14556. share/doc/qt5/qtwidgets/qtimeedit-members.html
  14557. share/doc/qt5/qtwidgets/qtimeedit-obsolete.html
  14558. share/doc/qt5/qtwidgets/qtimeedit.html
  14559. share/doc/qt5/qtwidgets/qtoolbar-members.html
  14560. share/doc/qt5/qtwidgets/qtoolbar-obsolete.html
  14561. share/doc/qt5/qtwidgets/qtoolbar.html
  14562. share/doc/qt5/qtwidgets/qtoolbox-members.html
  14563. share/doc/qt5/qtwidgets/qtoolbox-obsolete.html
  14564. share/doc/qt5/qtwidgets/qtoolbox.html
  14565. share/doc/qt5/qtwidgets/qtoolbutton-members.html
  14566. share/doc/qt5/qtwidgets/qtoolbutton-obsolete.html
  14567. share/doc/qt5/qtwidgets/qtoolbutton.html
  14568. share/doc/qt5/qtwidgets/qtooltip-members.html
  14569. share/doc/qt5/qtwidgets/qtooltip.html
  14570. share/doc/qt5/qtwidgets/qtreeview-members.html
  14571. share/doc/qt5/qtwidgets/qtreeview-obsolete.html
  14572. share/doc/qt5/qtwidgets/qtreeview.html
  14573. share/doc/qt5/qtwidgets/qtreewidget-members.html
  14574. share/doc/qt5/qtwidgets/qtreewidget-obsolete.html
  14575. share/doc/qt5/qtwidgets/qtreewidget.html
  14576. share/doc/qt5/qtwidgets/qtreewidgetitem-members.html
  14577. share/doc/qt5/qtwidgets/qtreewidgetitem-obsolete.html
  14578. share/doc/qt5/qtwidgets/qtreewidgetitem.html
  14579. share/doc/qt5/qtwidgets/qtreewidgetitemiterator-members.html
  14580. share/doc/qt5/qtwidgets/qtreewidgetitemiterator.html
  14581. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-pro.html
  14582. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-animatedtiles-qrc.html
  14583. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-example.html
  14584. share/doc/qt5/qtwidgets/qtwidgets-animation-animatedtiles-main-cpp.html
  14585. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-animation-h.html
  14586. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-pro.html
  14587. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-easing-qrc.html
  14588. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-example.html
  14589. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-form-ui.html
  14590. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-main-cpp.html
  14591. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-cpp.html
  14592. share/doc/qt5/qtwidgets/qtwidgets-animation-easing-window-h.html
  14593. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-example.html
  14594. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-main-cpp.html
  14595. share/doc/qt5/qtwidgets/qtwidgets-animation-moveblocks-moveblocks-pro.html
  14596. share/doc/qt5/qtwidget